Recombinant Human Protein PML (PML), partial

Promyelocytic leukemia protein (RING finger protein 71) (Tripartite motif-containing protein 19) (MYL) (PP8675) (RNF71) (TRIM19)

E.coli

QCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQA PWPLGADTPALDNVFFESLQRRLSVYRQIVDAQAV CTRCKESADFWCFECEQLLCAKCFEAHQWFLKHEA RPLAELRNQSVREFLDGTRKTNNIFCSNPNHRTPT LTSIYCRGCSKPLCCSCALLDSSHSELKCDISAEI QQRQEE

N-terminal 10xHis-tagged and C-terminal Myc-tagged

>85% as determined by SDS-PAGE.

Not tested

Ice packs

1 year

Functions via its association with PML-nuclear bodies in a wide range of important cellular processes, including tumor suppression, transcriptional regulation, apoptosis, senescence, DNA damage response, and viral defense mechanisms. Acts as the scaffold of PML-NBs allowing other proteins to shuttle in and out, a process which is regulated by SUMO-mediated modifications and interactions. Isoform PML-4 has a multifaceted role in the regulation of apoptosis and growth suppression: activates RB1 and inhibits AKT1 via interactions with PP1 and PP2A phosphatases respectively, negatively affects the PI3K pathway by inhibiting MTOR and activating PTEN, and positively regulates p53/TP53 by acting at different levels. Isoform PML-4 also: acts as a transcriptional repressor of TBX2 during cellular senescence and the repression is dependent on a functional RBL2/E2F4 repressor complex, regulates double-strand break repair in gamma-irradiation-induced DNA damage responses via its interaction with WRN, acts as a negative regulator of telomerase by interacting with TERT, and regulates PER2 nuclear localization and circadian function. Isoform PML-6 inhibits specifically the activity of the tetrameric form of PKM. The nuclear isoforms in concert with SATB1 are involved in local chromatin-loop remodeling and gene expression regulation at the MHC-I locus. Isoform PML-2 is required for efficient IFN-gamma induced MHC II gene transcription via regulation of CIITA. Cytoplasmic PML is involved in the regulation of the TGF-beta signaling pathway. PML also regulates transcription activity of ELF4 and can act as an important mediator for TNF-alpha- and IFN-alpha-mediated inhibition of endothelial cell network formation and migration.Exhibits antiviral activity against both DNA and RNA viruses. The antiviral activity can involve one or several isoform and can be enhanced by the permanent PML-NB-associated protein DAXX or by the recruitment of p53/TP53 within these structures. Isoform PML-4 restricts varicella zoster virus via sequestration of virion capsids in PML-NBs thereby preventing their nuclear egress and inhibiting formation of infectious virus particles. The sumoylated isoform PML-4 restricts rabies virus by inhibiting viral mRNA and protein synthesis. The cytoplasmic isoform PML-14 can restrict herpes simplex virus-1 replication by sequestering the viral E3 ubiquitin-protein ligase ICP0 in the cytoplasm. Isoform PML-6 shows restriction activity towards human cytomegalovirus and influenza A virus strains PR8 and ST364. Sumoylated isoform PML-4 and isoform PML-12 show antiviral activity against encephalomyocarditis virus by promoting nuclear sequestration of viral polymerase within PML NBs. Isoform PML-3 exhibits antiviral activity against poliovirus by inducing apoptosis in infected cells through the recruitment and the activation of p53/TP53 in the PML-NBs. Isoform PML-3 represses human foamy virus transcription by complexing the HFV transactivator, bel1/tas, preventing its binding to viral DNA. PML may positively regulate infectious hepatitis C viral production and isoform PML-2 may enhance adenovirus transcription.