« Back
Home /
Recombinant Human Valacyclovir hydrolase (BPHL)

Recombinant Human Valacyclovir hydrolase (BPHL)

Item no.	BM-RPC26339-100ug
Manufacturer	Biomatik
Amount	100ug
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Breast Cancer
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Biphenyl hydrolase-like protein (Biphenyl hydrolase-related protein) (Bph-rp)(Breast epithelial mucin-associated antigen) (MCNAA)
Similar products	Biphenyl hydrolase-like protein (Biphenyl hydrolase-related protein) (Bph-rp)(Breast epithelial mucin-associated antigen) (MCNAA)
Available
Gene Name	BPHL
Alternative Names	Biphenyl hydrolase-like protein (Biphenyl hydrolase-related protein) (Bph-rp)(Breast epithelial mucin-associated antigen) (MCNAA)
Uniprot	Q86WA6
Source	Baculovirus
Expression Region	38-291aa
AA Sequence	SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGS GETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDR DFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGG ITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYE GIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDG IRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLV PRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEF NKLAEDFLQ
Sequence Info	Full Length of Mature Protein
Tag Info	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW	32.8 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Serine hydrolase that catalyzes the hydrolytic activation of amino acid ester prodrugs of nucleoside analogs such as valacyclovir and valganciclovir. Activates valacyclovir to acyclovir. May play a role in detoxification processes. It is a specific alpha-amino acid ester hydrolase that prefers small, hydrophobic, and aromatic side chains and does not have a stringent requirement for the leaving group other than preferring a primary alcohol.
Function	Serine hydrolase that catalyzes the hydrolytic activation of amino acid ester prodrugs of nucleoside analogs such as valacyclovir and valganciclovir. Activates valacyclovir to acyclovir. May play a role in detoxification processes. It is a specific alpha-amino acid ester hydrolase that prefers small, hydrophobic, and aromatic side chains and does not have a stringent requirement for the leaving group other than preferring a primary alcohol.
Protein Families	AB hydrolase superfamily, Lipase family
Tissue Specificity	Expressed at high levels in liver and kidney and lower levels in heart, intestine and skeletal muscle.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Delivery expected until 8/21/2025

Express Delivery: Save 6 days

Compare

Add to wishlist

Get an offer