« Back
Home /
Recombinant Measles virus Nucleoprotein (N), partial

Recombinant Measles virus Nucleoprotein (N), partial

Manufacturer	Biomatik
Category	Infectious Diseases Viral Infections Coronavirus (COVID-19) Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Amount	100ug
Item no.	BM-RPC26357-100ug
eClass 6.1	34160400
eClass 9.0	42020190
Available
Gene Name	N
Alternative Names	Nucleocapsid protein Short name: NP Short name: Protein N
Uniprot	P04851
Source	Baculovirus
Expression Region	1-400aa
AA Sequence	MATLLRSLALFKRNKDKPPITSGSGGAIRGIKHII IVPIPGDSSITTRSRLLDRLVRLIGNPDVSGPKLT GALIGILSLFVESPGQLIQRITDDPDVSIRLLEVV QSDQSQSGLTFASRGTNMEDEADQYFSHDDPISSD QSRFGWFENKEISDIEVQDPEGFNMILGTILAQIW VLLAKAVTAPDTAADSELRRWIKYTQQRRVVGEFR LERKWLDVVRNIIAEDLSLRRFMVALILDIKRTPG NKPRIAEMICDIDTYIVEAGLASFILTIKFGIETM YPALGLHEFAGELSTLESLMNLYQQMGKPAPYMVN LENSIQNKFSAGSYPLLWSYAMGVGVELENSMGGL NFGRSYFDPAYFRLGQEMVRRSAGKVSSTLASELG ITAEDARLVSEIAMH
Sequence Info	Partial
Tag Info	N-terminal 10xHis-tagged
Theoretical MW	46.9 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Encapsidates the genome in a ratio of 1 N per 6 ribonucleotides, protecting it from nucleases. The nucleocapsid (NC) has a helical structure with either 12.35 or 11.64 N per turn, approximately 20 nm in diameter, with a hollow central cavity approximately 5 nm in diameter. The encapsidated genomic RNA is termed the NC and serves as template for transcription and replication. During replication, encapsidation by N is coupled to RNA synthesis and all replicative products are resistant to nucleases. N is released in the blood following lysis of measles infected cells, it interacts then with human FCGR2B on immune cells, inducing apoptosis and blocking inflammatory immune response. Ntail binds to a protein on human thymic epithelial cells, termed Nucleoprotein Receptor (NR), inducing growth arrest.
Function	Encapsidates the genome in a ratio of 1 N per 6 ribonucleotides, protecting it from nucleases. The nucleocapsid (NC) has a helical structure with either 12.35 or 11.64 N per turn, approximately 20 nm in diameter, with a hollow central cavity approximately 5 nm in diameter. The encapsidated genomic RNA is termed the NC and serves as template for transcription and replication. During replication, encapsidation by N is coupled to RNA synthesis and all replicative products are resistant to nucleases. N is released in the blood following lysis of measles infected cells, it interacts then with human FCGR2B on immune cells, inducing apoptosis and blocking inflammatory immune response. Ntail binds to a protein on human thymic epithelial cells, termed Nucleoprotein Receptor (NR), inducing growth arrest.
Subcellular location	Virion, Host cytoplasm
Protein Families	Paramyxoviruses nucleocapsid family

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Delivery expected until 6/27/2024