Comparison

Recombinant Human B-cell receptor CD22 (CD22), partial, Active Protein

Item no. BM-RPC26431-100ug
Manufacturer Biomatik
Amount 100 UG
Category
Type Proteins Recombinant
Format Lyophilized
Specific against Human (Homo sapiens)
Host Mammalian cells
Conjugate/Tag Unconjugated
Purity >90% by SDS-PAGE
Sequence DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEY
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias B-lymphocyte cell adhesion molecule (BL-CAM, Sialic acid-binding Ig-like lectin 2, Siglec-2, T-cell surface antigen Leu-14, CD22)
Similar products B-lymphocyte cell adhesion molecule (BL-CAM) (Sialic acid-binding Ig-like lectin 2) (Siglec-2) (T-cell surface antigen Leu-14) (CD22)
Shipping Condition Cool pack
Available
Specificity Human (Homo sapiens)
Manufacturer - Category
Protein
Manufacturer - Targets
CD22
Manufacturer - Conjugate / Tag
Unconjugated, C-Terminal 6Xhis-Tagged
Shipping Temperature
Ice packs
Storage Conditions
-20°C. Avoid repeated freeze/thaw cycles.
Molecular Weight (Theoretical)
77.9kDa
Manufacturer - Research Area
Cancer
Protein Length
Partial
Protein Type
Active Recombinant Protein
Expression Region
20~687aa
Restrictions
For Research Use Only. Not for use in diagnostic procedures.
Expiration
12 months
Reconstitution
Refer to the datasheet/CoA included in the product pouch.
Endotoxin
<1.0 EU/ug, by LAL method
Quality Systems
This product is manufactured at ISO 9001 certified facilities.
Quality Guarantee
This product carries the Biomatik 100% Quality Guarantee. Please refer to the Terms and Conditions for details.
Long Description
Recombinant Human B-cell receptor CD22 (CD22), partial, Active Protein is a purified Active Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Mammalian Cell. Endotoxin Level: <1.0 EU/ug as determined by LAL method. Species: Human (Homo sapiens). Target Name: CD22. Target Synonyms: B-lymphocyte cell adhesion molecule (BL-CAM; Sialic acid-binding Ig-like lectin 2; Siglec-2; T-cell surface antigen Leu-14; CD22). Accession Number: P20273. Expression Region: 20~687aa. Tag Info: C-Terminal 6Xhis-Tagged. Theoretical MW: 77.9kDa. Buffer: Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 Storage: -20°C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Short Description
Recombinant Human B-cell receptor CD22 (CD22), partial, Active Protein is a purified Active Recombinant Protein.
Buffer
Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Activity
Biologically Active

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 UG
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close