Item no. |
BM-RPC26435-50ug |
Manufacturer |
Biomatik
|
Amount |
50ug |
Category |
|
Type |
Proteins Recombinant |
Specific against |
Human (Homo sapiens) |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Epithelial cell kinase (Tyrosine-protein kinase receptor ECK) (ECK) |
Similar products |
Epithelial cell kinase (Tyrosine-protein kinase receptor ECK) (ECK) |
Available |
|
Gene Name |
EPHA2 |
Alternative Names |
Epithelial cell kinase (Tyrosine-protein kinase receptor ECK) (ECK) |
Uniprot |
P29317 |
Source |
Mammalian cell |
Expression Region |
24-534aa |
AA Sequence |
AQGKEVVLLDFAAAGGELGWLTHPYGKGWDLMQNI MNDMPIYMYSVCNVMSGDQDNWLRTNWVYRGEAER IFIELKFTVRDCNSFPGGASSCKETFNLYYAESDL DYGTNFQKRLFTKIDTIAPDEITVSSDFEARHVKL NVEERSVGPLTRKGFYLAFQDIGACVALLSVRVYY KKCPELLQGLAHFPETIAGSDAPSLATVAGTCVDH AVVPPGGEEPRMHCAVDGEWLVPIGQCLCQAGYEK VEDACQACSPGFFKFEASESPCLECPEHTLPSPEG ATSCECEEGFFRAPQDPASMPCTRPPSAPHYLTAV GMGAKVELRWTPPQDSGGREDIVYSVTCEQCWPES GECGPCEASVRYSEPPHGLTRTSVTVSDLEPHMNY TFTVEARNGVSGLVTSRSFRTASVSINQTEPPKVR LEGRSTTSLSVSWSIPPPQQSRVWKYEVTYRKKGD SNSYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQE GQGAGSKVHEFQTLSPEGSGN |
Sequence Info |
Partial |
Tag Info |
N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Theoretical MW |
61.2 kDa |
Purity |
>85% as determined by SDS-PAGE. |
Storage Buffer |
Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Endotoxin Level |
Not tested |
Biological Activity |
Not tested |
Shipping Condition |
Ice packs |
Storage |
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles. |
Expiry Date |
1 year |
Restriction |
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals. |
Relevance |
Receptor tyrosine kinase which binds promiscuously membrane-bound ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Activated by the ligand ephrin-A1/EFNA1 regulates migration, integrin-mediated adhesion, proliferation and differentiation of cells. Regulates cell adhesion and differentiation through DSG1/desmoglein-1 and inhibition of the ERK1/ERK2 signaling pathway. May also participate in UV radiation-induced apoptosis and have a ligand-independent stimulatory effect on chemotactic cell migration. During development, may function in distinctive aspects of pattern formation and subsequently in development of several fetal tissues. Involved for instance in angiogenesis, in early hindbrain development and epithelial proliferation and branching morphogenesis during mammary gland development. Engaged by the ligand ephrin-A5/EFNA5 may regulate lens fiber cells shape and interactions and be important for lens transparency development and maintenance. With ephrin-A2/EFNA2 may play a role in bone remodeling through regulation of osteoclastogenesis and osteoblastogenesis. Acts as a receptor for hepatitis C virus in hepatocytes and facilitates its cell entry. Mediates HCV entry by promoting the formation of the CD81-CLDN1 receptor complexes that are essential for HCV entry and by enhancing membrane fusion of cells expressing HCV envelope glycoproteins. |
Function |
Receptor tyrosine kinase which binds promiscuously membrane-bound ephrin-A family ligands residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. Activated by the ligand ephrin-A1/EFNA1 regulates migration, integrin-mediated adhesion, proliferation and differentiation of cells. Regulates cell adhesion and differentiation through DSG1/desmoglein-1 and inhibition of the ERK1/ERK2 (MAPK3/MAPK1, respectively) signaling pathway. May also participate in UV radiation-induced apoptosis and have a ligand-independent stimulatory effect on chemotactic cell migration. During development, may function in distinctive aspects of pattern formation and subsequently in development of several fetal tissues. Involved for instance in angiogenesis, in early hindbrain development and epithelial proliferation and branching morphogenesis during mammary gland development. Engaged by the ligand ephrin-A5/EFNA5 may regulate lens fiber cells shape and interactions and be important for lens transparency development and maintenance. With ephrin-A2/EFNA2 may play a role in bone remodeling through regulation of osteoclastogenesis and osteoblastogenesis. |
Involvement in disease |
Cataract 6, multiple types (CTRCT6) |
Subcellular location |
Cell membrane, Single-pass type I membrane protein, Cell projection, ruffle membrane, Single-pass type I membrane protein, Cell projection, lamellipodium membrane, Single-pass type I membrane protein, Cell junction, focal adhesion |
Protein Families |
Protein kinase superfamily, Tyr protein kinase family, Ephrin receptor subfamily |
Tissue Specificity |
Expressed in brain and glioma tissue and glioma cell lines (at protein level). Expressed most highly in tissues that contain a high proportion of epithelial cells, e.g. skin, intestine, lung, and ovary. |
Paythway |
MAPKsignalingpathway |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.