« Back
Home /
Recombinant Rat Peripheral myelin protein 22 (Pmp22)

Recombinant Rat Peripheral myelin protein 22 (Pmp22)

Item no.	BM-RPC26453-100ug
Manufacturer	Biomatik
Amount	100ug
Category	Oncology By Cell Type Hematology Leukemia Lymphoma Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Rat (Rattus norvegicus)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Protein CD25 (SR13 myelin protein) (Schwann cell membrane glycoprotein) (SAG) (Cd25) (Pmp-22)
Similar products	Protein CD25 (SR13 myelin protein) (Schwann cell membrane glycoprotein) (SAG) (Cd25) (Pmp-22)
Available
Gene Name	Pmp22
Alternative Names	Protein CD25 (SR13 myelin protein) (Schwann cell membrane glycoprotein) (SAG) (Cd25) (Pmp-22)
Uniprot	P25094
Source	in vitro E.coli expression system
Expression Region	1-160aa
AA Sequence	MLLLLLGILFLHIAVLVLLFVSTIVSQWLVGNGHR TDLWQNCTTSALGAVQHCYSSSVSEWLQSVQATMI LSVIFSVLSLFLFFCQLFTLTKGGRFYITGVFQIL AGLCVMSAAAIYTVRHSEWHVNNDYSYGFAYILAW VAFPLALLSGIIYVILRKRE
Sequence Info	Full Length
Tag Info	N-terminal 10xHis-tagged
Theoretical MW	23.4 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Might be involved in growth regulation, and in myelinization in the peripheral nervous system.
Function	Might be involved in growth regulation, and in myelinization in the peripheral nervous system.
Subcellular location	Cell membrane, Multi-pass membrane protein
Protein Families	PMP-22/EMP/MP20 family
Tissue Specificity	Found exclusively in the peripheral nervous system. Present in both myelinating and nonmyelinating Schwann cells. Found in the tumors of Schwann cell lineage where axons are present (neurofibromas) but not where axons are absent (schwannomas).

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Delivery expected until 10/9/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer