« Back
Home /
Recombinant Human P2Y purinoceptor 12 (P2RY12)

Recombinant Human P2Y purinoceptor 12 (P2RY12)

Item no.	BM-RPC26478-50ug
Manufacturer	Biomatik
Amount	50ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	ADP-glucose receptor (ADPG-R) (P2T) (P2Y(AC)) (P2Y(cyc)) (P2Y12 platelet ADP receptor) (P2Y(ADP)) (SP1999) (HORK3) (P2Y12)
Similar products	ADP-glucose receptor (ADPG-R) (P2T) (P2Y(AC)) (P2Y(cyc)) (P2Y12 platelet ADP receptor) (P2Y(ADP)) (SP1999) (HORK3) (P2Y12)
Available
Gene Name	P2RY12
Alternative Names	ADP-glucose receptor (ADPG-R) (P2T) (P2Y(AC)) (P2Y(cyc)) (P2Y12 platelet ADP receptor) (P2Y(ADP)) (SP1999) (HORK3) (P2Y12)
Uniprot	Q9H244
Source	in vitro E.coli expression system
Expression Region	1-342aa
AA Sequence	MQAVDNLTSAPGNTSLCTRDYKITQVLFPLLYTVL FFVGLITNGLAMRIFFQIRSKSNFIIFLKNTVISD LLMILTFPFKILSDAKLGTGPLRTFVCQVTSVIFY FTMYISISFLGLITIDRYQKTTRPFKTSNPKNLLG AKILSVVIWAFMFLLSLPNMILTNRQPRDKNVKKC SFLKSEFGLVWHEIVNYICQVIFWINFLIVIVCYT LITKELYRSYVRTRGVGKVPRKKVNVKVFIIIAVF FICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVK ESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKC PNSATSLSQDNRKKEQDGGDPNEETPM
Sequence Info	Full Length
Tag Info	N-terminal 10xHis-tagged
Theoretical MW	42.2 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Receptor for ADP and ATP coupled to G-proteins that inhibit the adenylyl cyclase second messenger system. Not activated by UDP and UTP. Required for normal platelet aggregation and blood coagulation.
Function	Receptor for ADP and ATP coupled to G-proteins that inhibit the adenylyl cyclase second messenger system. Not activated by UDP and UTP. Required for normal platelet aggregation and blood coagulation.
Involvement in disease	Bleeding disorder, platelet-type 8 (BDPLT8)
Subcellular location	Cell membrane, Multi-pass membrane protein
Protein Families	G-protein coupled receptor 1 family
Tissue Specificity	Highly expressed in the platelets, lower levels in the brain. Lowest levels in the lung, appendix, pituitary and adrenal gland. Expressed in the spinal cord and in the fetal brain.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Delivery expected until 8/28/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer