« Back
Home /
Recombinant Mouse Reactive oxygen species modulator 1 (Romo1)

Recombinant Mouse Reactive oxygen species modulator 1 (Romo1)

Item no.	BM-RPC26481-100ug
Manufacturer	Biomatik
Amount	100ug
Category	Peptides & Proteins Recombinant Proteins Cell Biology Cell Status Oxidative Stress
Type	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Protein MGR2 homolog (ROS modulator 1)
Similar products	Protein MGR2 homolog (ROS modulator 1)
Available
Gene Name	Romo1
Alternative Names	Protein MGR2 homolog (ROS modulator 1)
Uniprot	P60603
Source	in vitro E.coli expression system
Expression Region	1-79aa
AA Sequence	MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGA LFGTFSCLRIGMRGRELMGGIGKTMMQSGGTFGTF MAIGMGIRC
Sequence Info	Full Length
Tag Info	N-terminal 10xHis-tagged
Theoretical MW	11.0 kDa
Purity	>85% as determined by SDS-PAGE.
Storage Buffer	Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level	Not tested
Biological Activity	Not tested
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Has antibacterial activity against a variety of bacteria including S.aureus, P.aeruginosa and M.tuberculosis. Acts by inducing bacterial membrane breakage.Induces production of reactive oxygen species which are necessary for cell proliferation. May play a role in inducing oxidative DNA damage and replicative senescence. May play a role in the coordination of mitochondrial morphology and cell proliferation.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Delivery expected until 10/2/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer