« Back
Home /
Recombinant Human C-X-C motif chemokine 14(CXCL14) (Active)

Recombinant Human C-X-C motif chemokine 14(CXCL14) (Active)

Item no.	BM-RPC26798-50ug
Manufacturer	Biomatik
Amount	50ug
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	C-X-C Motif Chemokine 14, Chemokine BRAKm MIP-2G, Small-Inducible Cytokine B14, CXCL14, MIP2G, NJAC, SCYB14
Similar products	CXCL14, MIP2G, NJAC, SCYB14, C-X-C Motif Chemokine 14, Chemokine BRAKm MIP-2G, Small-Inducible Cytokine B14
Available
Gene Name	CXCL14
Alternative Names	C-X-C Motif Chemokine 14, Chemokine BRAKm MIP-2G, Small-Inducible Cytokine B14, CXCL14, MIP2G, NJAC, SCYB14
Uniprot	O95715
Source	E.coli
Expression Region	35-111aa
AA Sequence	SKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVI ITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNE KRRVYEE
Sequence Info	Full Length of Mature Protein
Tag Info	Tag-Free
Theoretical MW	9.4 kDa
Purity	>95% as determined by SDS-PAGE.
Storage Buffer	Lyophilized from a 0.2 um filtered 20 mM Tris-HCl, 1 M NaCl, pH 8.5
Endotoxin Level	Less than 1.0 EU/ug as determined by LAL method.
Biological Activity	The ED50 as determined by its ability to induce calcium flux of prostaglandin E2 treated THP1 human acute monocytic leukemia cells is typically 1-10 ng/mL.
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Human Chemokine (C-X-C Motif) Ligand 14 (CXCL14) is constitutively expressed in certain normal tissues but is reduced or absent from many established tumor cell lines and human cancers. CXCL14 is known to be a chemoattractant for monocyte and dendritic cells. CXCL14 inhibits angiogenesis and exhibits antimicrobial activities. Mature human and mouse CXCL14 differ by only 2 amino acid residues.
Function	Potent chemoattractant for neutrophils, and weaker for dendritic cells. Not chemotactic for T-cells, B-cells, monocytes, natural killer cells or granulocytes. Does not inhibit proliferation of myeloid progenitors in colony formation assays.
Subcellular location	Secreted
Protein Families	Intercrine alpha (chemokine CxC) family
Tissue Specificity	Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Highly expressed in normal tissue without inflammatory stimuli and infrequently expressed in cancer cell lines. Weakly expressed in monocyte-derived dendritic cells. Not detected in lung or unstimulated peripheral blood lymphocytes.
Paythway	Chemokinesignalingpathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Delivery expected until 9/18/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer