Comparison

Recombinant Human Fibroblast growth factor 8 (FGF8), partial (Active)

Item no. BM-RPC26849-1mg
Manufacturer Biomatik
Amount 1mg
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Fibroblast growth factor 8,Androgen-induced growth factor,Heparin-binding growth factor 8,AIGF,HBGF-8,FGF-8B
Similar products Heparin-binding growth factor 8, Fibroblast growth factor 8, Androgen-induced growth factor, HBGF-8, AIGF, FGF-8B
Available
Gene Name
FGF8
Alternative Names
Fibroblast growth factor 8, Androgen-induced growth factor, Heparin-binding growth factor 8, AIGF, HBGF-8, FGF-8B
Uniprot
P55075-3
Source
E.coli
Expression Region
23-215aa
AA Sequence
QVTVQSSPNFTQHVREQSLVTDQLSRRLIRTYQLY SRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDT FGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDC VFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKG SKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYP PFTRSLRGSQRTWAPEPR
Sequence Info
Partial of Isoform 3
Tag Info
Tag-Free
Theoretical MW
22.5 kDa
Purity
>95% as determined by SDS-PAGE.
Storage Buffer
Lyophilized from a 0.2 um filtered 1xPBS, pH 7.4
Endotoxin Level
Less than 1.0 EU/ug as determined by LAL method.
Biological Activity
The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 100 ng/ml.
Shipping Condition
Ice packs
Storage
Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date
1 year
Restriction
For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance
Fibroblast growth factor 8 (FGF-8) is a member of the fibroblast growth factor family. It is discovered as a growth factor essential for the androgen--dependent growth of mouse mammary carcinoma cells. Mouse FGF-8b shares 100% aa identity with human FGF-8b. FGF-8 is widely expressed during embryogenesis, and mediates epithelial--mesenchymal transitions. It plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. It is required for normal brain, eye, ear, limb development during embryogenesis and normal development of the gonadotropin-releasing hormone (GnRH) neuronal system.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close