Recombinant Mouse Interleukin-33 (Il33), partial (Active)

Interleukin 33, IL-33, IL33, C9orf26, NKHEV, Interleukin-1 family member 11, DVS27, NF-HEV and IL- 1F11

E.coli

SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVIN VDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKK LMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPE QAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLAL VEEKDESCNNIMFKLSKI

Tag-Free

>95% as determined by SDS-PAGE.

Less than 1.0 EU/ug as determined by LAL method.

Ice packs

1 year

Mouse Interleukin 33 (IL-33) is a 30 kDa proinflammatory cytokine which may also regulates gene transcription in producer cells. IL-33 is constitutively expressed in smooth muscle and airway epithelia. IL-33 was identified based on sequence and structural homology with IL-1 family cytokines. It is up?regulated in arterial smooth muscle, dermal fibroblasts, and keratinocytes following IL-1 alpha or IL?1 beta stimulation. IL-33 is structurally related to IL-1, which induces helper T cells to produce type 2 cytokines and acts through the receptor IL1RL-1. BindingIL-33 to this receptor activates NF-kappa-B and MAP kinases and induces in vitro Th2 cells to produce cytokines. In vivo, IL-33 induces the expression of IL-4, IL-5, IL-13 and also leads to severe pathological changes in mucosal organs.

Nucleus, Chromosome, Cytoplasmic vesicle, secretory vesicle, Secreted