« Back
Home /
Recombinant Human Interferon lambda-3 (IFNL3) (Active)

Recombinant Human Interferon lambda-3 (IFNL3) (Active)

Item no.	BM-RPC26893-50ug
Manufacturer	Biomatik
Amount	50ug
Category	Neuroscience Neural Transcription Factors Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Interleukin-28B, IL-28B, Cytokine Zcyto22, Interferon Lambda-3, IFN-Lambda-3, Interferon Lambda-4, IFN-Lambda-4, Interleukin-28C, IL-28C, IL28B, IFNL3, IFNL4, IL28C, ZCYTO22
Similar products	IL28B, IFNL3, IFNL4, IL28C, ZCYTO22, Interleukin-28B, Cytokine Zcyto22, Interleukin-28C, IL-28B, IL-28C, Interferon Lambda-3, IFN-Lambda-3, Interferon Lambda-4, IFN-Lambda-4
Available
Gene Name	IFNL3
Alternative Names	Interleukin-28B, IL-28B, Cytokine Zcyto22, Interferon Lambda-3, IFN-Lambda-3, Interferon Lambda-4, IFN-Lambda-4, Interleukin-28C, IL-28C, IL28B, IFNL3, IFNL4, IL28C, ZCYTO22
Uniprot	Q8IZI9
Source	Mammalian cell
Expression Region	22-196aa
AA Sequence	VPVARLRGALPDARGCHIAQFKSLSPQELQAFKRA KDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERP VALEAELALTLKVLEATADTDPALGDVLDQPLHTL HHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEA PKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV
Sequence Info	Full Length of Mature Protein
Tag Info	C-terminal 6xHis-tagged
Theoretical MW	20.67 kDa
Purity	>95% as determined by SDS-PAGE.
Storage Buffer	Lyophilized from a 0.2 um filtered 20 mM PB, 150 mM NaCl, 1 mM EDTA, pH 7.4
Endotoxin Level	Less than 1.0 EU/ug as determined by LAL method.
Biological Activity	The ED50 as determined by its ability to binding IL10RB used funtional ELISA is less than 10 ug/ml.
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Interleukin-28B, also known as Cytokine Zcyto22, Interferon lambda-3, Interferon lambda-4, IFNL3, IFNL4, ZCYTO22 and IL28B, is a secreted cytokine which belongs to the IL-28/IL-29 family. IL-28 has also been shown to play a role in the adaptive immune response. IL28B has immunomodulatory activity and up-regulates MHC class I antigen expression. IL28B displays potent antiviral activity and antitumor activity. In addition, IL28B is a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IL28RA. The ligand/receptor complex seems to signal through the Jak-STAT pathway.
Function	Cytokine with antiviral, antitumour and immunomodulatory activities. Plays a critical role in the antiviral host defense, predominantly in the epithelial tissues. Acts as a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IFNLR1, and receptor engagement leads to the activation of the JAK/STAT signaling pathway resulting in the expression of IFN-stimulated genes (ISG), which mediate the antiviral state. Has a restricted receptor distribution and therefore restricted targets
Subcellular location	Secreted
Protein Families	Lambda interferon family
Paythway	Jak-STATsignalingpathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Delivery expected until 12/18/2025

Compare

Add to wishlist

Get an offer

Request delivery time