« Back
Home /
Recombinant Human Interleukin-3 (IL3) (Active)

Recombinant Human Interleukin-3 (IL3) (Active)

Item no.	BM-RPC26898-1mg
Manufacturer	Biomatik
Amount	1mg
Category	Peptides & Proteins Recombinant Proteins Cell Biology Cell Culture Cytokines
Type	Proteins Recombinant
Specific against	Human (Homo sapiens)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Interleukin-3, IL-3, Hematopoietic Growth Factor, Mast Cell Growth Factor, MCGF, Multipotential Colony-Stimulating Factor, P-Cell-Stimulating Factor, IL3
Similar products	IL3, IL-3, Interleukin-3, MCGF, Mast Cell Growth Factor, Hematopoietic Growth Factor, Multipotential Colony-Stimulating Factor, P-Cell-Stimulating Factor
Available
Gene Name	IL3
Alternative Names	Interleukin-3, IL-3, Hematopoietic Growth Factor, Mast Cell Growth Factor, MCGF, Multipotential Colony-Stimulating Factor, P-Cell-Stimulating Factor, IL3
Uniprot	P08700
Source	Mammalian cell
Expression Region	20-152aa
AA Sequence	APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLL DFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQN ASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWN EFRRKLTFYLKTLENAQAQQTTLSLAIF
Sequence Info	Full Length of Mature Protein
Tag Info	C-terminal 6xHis-tagged
Theoretical MW	16.1 kDa
Purity	>95% as determined by SDS-PAGE.
Storage Buffer	Lyophilized from a 0.2 um filtered 1xPBS, pH 7.4
Endotoxin Level	Less than 1.0 EU/ug as determined by LAL method.
Biological Activity	The ED50 as determined in a cell proliferation assay using TF?1 human erythroleukemic cells is less than 2 ng/ml.
Shipping Condition	Ice packs
Storage	Short term: -20CC; Long term: -80CC. Minimize freeze and thaw cycles.
Expiry Date	1 year
Restriction	For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance	Interleukin-3 (IL-3) is a potent growth promoting cytokine. IL-3 can stimulate the proliferation and differentiation of pluripotent hematopoietic stem cells as well as various lineage committed progenitors. IL-3 exerts its biological function through binding to specific cell surface receptors. The amino acid sequences of this protein among different species share relatively low identity and its activity is highly species-specific. IL-3 has also been shown to possess neurotrophic activity, and is thought to be associated with neurologic disorders.
Function	Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.; FUNCTION
Subcellular location	Secreted
Protein Families	IL-3 family
Tissue Specificity	Activated T-cells, mast cells, natural killer cells.
Paythway	Jak-STATsignalingpathway

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1mg

available

Delivery expected until 9/4/2025

Express Delivery: Save 1 days

Compare

Add to wishlist

Get an offer