Recombinant Mouse Interleukin-15 receptor subunit alpha (Il15ra), partial (Active)

Interleukin-15 receptor subunit alpha, Il15ra, sIL-15 receptor subunit alpha

Mammalian cell

GTTCPPPVSIEHADIRVKNYSVNSRERYVCNSGFK RKAGTSTLIECVINKNTNVAHWTTPSLKCIRDPSL AHYSPVPTVVTPKVTSQPESPSPSAKEPEAFSPKS DTAMTTETAIMPGSRLTPSQTTSAGTTGTGSHKSS RAPSLAATMTLEPTASTSLRITEISPHSSKMTK

C-terminal FC-tagged

>90% as determined by SDS-PAGE.

Less than 1.0 EU/ug as determined by LAL method.

Ice packs

1 year

Mouse interleukin-15 receptor subunit alpha, also known as Il15ra, is a high-affinity receptor for interleukin-15. Il15ra associates as a heterotrimer with the IL-2 receptor beta and gamma subunits (Common gamma chain, or gamma c) to initiate signal transduction. It can signal both in cis and trans where IL15R from one subset of cells presents IL15 to neighboring IL2RG-expressing cells. Il15ra is expressed in special cells including a wide variety of Tand B cells and non-lymphoid cells. Human Il15ra shares 45% amino acid sequence homology with the mouse form of the receptor. Eight isoforms of IL-15 R alpha mRNA have been identified, resulting from alternative splicing events involving different exons.

Membrane, Single-pass type I membrane protein, Nucleus membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Soluble interleukin-15 receptor subunit alpha: Secreted, extracellular space