Comparison

IP-10, human, recombinant (CXCL10) European Partner

Item no. BNTH-CHM-330-0,025mg
Manufacturer BIOSYNTH
Amount 0.025 mg
Quantity options 1 mg
Category
Type Proteins Recombinant
Specific against other
Host E.coli
Purity Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Small inducible cytokine B10, CXCL10, 10 kDa interferon-gamma-induced protein, Gamma-IP10, IP-10, chemokine (C-X-C motif) ligand 10, C7, IFI10, INP10, crg-2, mob-1, SCYB10, gIP-10, rHCXCL10
Available
Manufacturer - Category
Life Sciences / Peptides and Biochemicals / Research Peptides
Shipping Temperature
No Dry Ice
Storage Conditions
-20 C
Model
IP-10 Human Recombinant (CXCL10)
Description
Introduction: Chemokine (C-X-C motif) ligand 10 (CXCL10) is a small cytokine belonging to the CXC chemokine family. CXCL10 is secreted by several cell types in response to IFN. These cell types include monocytes, endothelial cells and fibroblasts. CXCL10 has been attributed to several roles, such as chemoattraction for monocytes and T cells, promotion of T cell adhesion to endothelial cells, antitumor activity, and inhibition of bone marrow colony formation and angiogenesis. The gene for CXCL10 is located on human chromosome 4 in a cluster among several other CXC chemokines. This chemokine elicits its effects by binding to the cell surface chemokine receptor CXCR3. The three-dimensional crystal structure of this chemokine has been determined under 3 different conditions to a resolution of up to 1.92A.Description: IP-10 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 77 amino acids and having a molecular mass of 8.6kDa. The IP-10 is purified by proprietary chromatographic techniques.Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.Formulation: Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).Solubility: It is recommended to reconstitute the lyophilized IP-10 in sterile 18MΩ -cm H2O not less than 100µ g/ml, which can then be further diluted to other aqueous solutions.Stability: Lyophilized IP-10 although stable at room temperature for 3 weeks, should be stored desiccated below -18° C. Upon reconstitution CXCL10 should be stored at 4° C between 2-7 days and for future use below -18° C. For long term storage it is recommended to add a carrier protein (0.1% HAS or BSA).Please prevent freeze-thaw cycles.
Application info
CXCL10 has been attributed to several roles, such as chemoattraction for monocytes and T cells, promotion of T cell adhesion to endothelial cells, antitumor activity, and inhibition of bone marrow colony formation and angiogenesis
One letter code
VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKA IKNLLKAVSKEMSKRSP

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 0.025 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close