Comparison

Aminopeptidase P1, Human (His-SUMO) European Partner

Item no. HY-P700260-1ea
Manufacturer MedChem Express
Amount 1 ea
Category
Type Proteins Recombinant
Specific against other
Sequence PPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFIDGDRIDAPSVKEHLLLDLG
Smiles PPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSAGTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVDPLIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKDKVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLSLDEVYLIDSGAQYKDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSGLDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVVLVVPVKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKELQKQGRQEALEWLIRETQPISKQH
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Aminopeptidase P1 Protein, Human (His-SUMO),Human,E. coli
Shipping condition Room temperature
Available
Manufacturer - Type
Recombinant Proteins
Shipping Temperature
Room temperature
Molecular Weight
Approximately 85.8 kDa
Product Description
Aminopeptidase P1 Protein, a metalloaminopeptidase, crucially catalyzes the removal of penultimate prolyl residues from peptide N-termini, including substrates like Arg-Pro-Pro. This activity significantly contributes to specific peptide degradation, exemplified in bradykinin processing. Aminopeptidase P1's selective prolyl cleavage underscores its importance in modulating peptide structures and functions within biological systems. Aminopeptidase P1 Protein, Human (His-SUMO) is the recombinant human-derived Aminopeptidase P1 protein, expressed by E. coli , with N-6*His, N-SUMO labeled tag. The total length of Aminopeptidase P1 Protein, Human (His-SUMO) is 622 a.a., with molecular weight of ~85.8 kDa.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 ea
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close