« Back
Home /
SARS-CoV-2 (COVID-19) NSP5 Recombinant Protein

SARS-CoV-2 (COVID-19) NSP5 Recombinant Protein

Item no.	PRS-20-252-0.1mg
Manufacturer	ProSci
Amount	0.1 mg
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid
Specific against	other
Conjugate/Tag	GST
Purity	GSH-Agarose (0.95)
Dry ice	Yes
Sequence	Native Sequence:<br>MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSSGFR
NCBI	ORF1ab
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	SARS-CoV2-NSP5, SARS-CoV-2 NSP5, NSP5 SARS-CoV-2, 3CLPro, 3CL-Pro
Available
Manufacturer - Conjugate / Tag	N-Term GST Uncleaved
Storage Conditions	Store at -70 °C. Avoid repeated freeze-thaw cycles.
Molecular Weight	Mono-Isotopic Mass: 60, 581.13 daltons Average Mass: 60, 620.81 daltons
Concentration	Batch dependent
Buffer	50 mM Tris-HCl pH 7.5, 270 mM Sucrose, 150 mM NaCl, 0.1 mM EGTA, 0.1 % 2-mercaptoethanol, 0.03 % Brij-35
NCBI Official Name	ORF1a polyprotein; ORF1ab polyprotein
NCBI Organism	Severe acute respiratory syndrome coronavirus 2
Disclaimer	Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.1 mg

available

Delivery expected until 9/4/2025

Express Delivery: Save 15 days

Compare

Add to wishlist

Get an offer