« Back
Home /
NAD Kinase Recombinant Protein

NAD Kinase Recombinant Protein

Item no.	PRS-91-250-0.05mg
Manufacturer	ProSci
Amount	0.05 mg
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Liquid
Specific against	other
Conjugate/Tag	HIS
Purity	Greater than 95% as determined by reducing SDS-PAGE.<br />Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Dry ice	Yes
Sequence	MGSSHHHHHHSSGLVPRGSHMSLHGPCPVTTFGPKACVLQNPQTIMHIQDPASQRLTWNKSPKSVLVIKKMRDASLLQPFKELCTHLMEENMIVYVEKKVLEDPAIASDESFGAVKKKFCTFREDYDDISNQIDFIICLGGDGTLLYASSLFQGSVPPVMAFHLGSLGFLTPFSFENFQSQVTQVIEGNAAVVLRSRLKVRVVKELRGKKTAVHNGLGEKGSQAAGLDMDVGKQAMQYQVLNEVVIDRGPSSYLS
NCBI	NADK
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	NAD Kinase, Poly(P)/ATP NAD Kinase, NADK
Available
Manufacturer - Applications	This recombinant protein can be used for biological assays. For research use only.
Manufacturer - Conjugate / Tag	N-6 His tag
Storage Conditions	Store at -20°C, stable for 6 months after receipt. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Molecular Weight	44.4 kD
Background	NAD Kinase (NADK) is an enzyme that belongs to the NAD Kinase family. It is a widely expressed enzyme, but it is not detected in skeletal muscle. NADK converts Nicotinamide Adenine Dinucleotide (NAD+) into NADP+, through phosphorylating the NAD+ coenzyme. NADP+ is an essential coenzyme in metabolism and provides reducing power to biosynthetic processes such as fatty acid biosynthesis. The structure of the NADK from the archaean Archaeoglobus fulgidus has been determined.
Buffer	Supplied as a 0.2 um filtered solution of 50mM TrisHCl, 150mM NaCl, 1mM DTT, pH 7.5. It is not recommended to reconstitute to a concentration less than 100 ug/ml.
NCBI Official Name	NAD kinase
NCBI Organism	Homo sapiens
Disclaimer	Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.05 mg

available

Delivery expected until 9/4/2025

Express Delivery: Save 8 days

Compare

Add to wishlist

Get an offer