« Back
Home /
TRAIL R3 Recombinant Protein

TRAIL R3 Recombinant Protein

Item no.	PRS-91-455-0.05mg
Manufacturer	ProSci
Amount	0.05 mg
Category	Oncology Neuroscience Neuroinflammation Metabolism Diabetes Neural Epigenetics By Cell Type Carcinoma Hematology Lymphoma Melanoma Sarcoma Peptides & Proteins Recombinant Proteins Cell Biology Obesity Cell Culture Cytokines Cell Status Necrosis Apoptosis Cardiovascular Research Ischemia & Reperfusion Injury
Type	Proteins Recombinant
Format	Lyophilized
Specific against	other
Conjugate/Tag	HIS
Purity	Greater than 95% as determined by reducing SDS-PAGE.<br />Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Sequence	ATTARQEEVPQQTVAPQQQRHSFKGEECPAGSHRSEHTGACNPCTEGVDYTNASNNEPSCFPCTVCKSDQKHKSSCTMTRDTVCQCKEGTFRNENSPEMCRKCSRCPSGEVQVSNCTSWDDIQCVEEFGANATVETPAAEETMNTSPGTPAPAAEETMNTSPGTPAPAAEETMTTSPGTPAPAAEETMTTSPGTPAVDHHHHHH
NCBI	TNFRSF10C
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Tumor Necrosis Factor Receptor Superfamily Member 10C, Antagonist Decoy Receptor for TRAIL/Apo-2L, Decoy TRAIL Receptor Without Death Domain, Decoy Receptor 1, DcR1, Lymphocyte Inhibitor of TRAIL, TNF-Related Apoptosis-Inducing Ligand Receptor 3, TRAIL Receptor 3, TRAIL-R3, TRAIL Receptor Without an Intracellular Domain, CD263, TNFRSF10C, LIT, TRAILR3, TRID
Available
Manufacturer - Applications	This recombinant protein can be used for biological assays. For research use only.
Manufacturer - Conjugate / Tag	C-6 His tag
Storage Conditions	Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Molecular Weight	21.78 kD
Background	Tumor Necrosis Factor Receptor Superfamily Member 10C (TNFRSF10C) is a glycosyl-phosphatidylinositol-linked membrane protein which binds TRAIL with high affinity. TNFRSF10C has the TRAIL-binding extracellular cysteine-rich domains, lacks the intracellular signaling domain. As a result, binding of TRAIL to TRAIL R3 doesn’t transduce an apoptosis signal. The expression of TRAIL R3 gene has been shown to protect cells bearing TRAIL R1 and/or TRAIL R2 from TRAIL-induced apoptosis.
Buffer	Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.2. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
NCBI Official Name	tumor necrosis factor receptor superfamily member 10c
NCBI Organism	Homo sapiens
Disclaimer	Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.05 mg

available

Delivery expected until 9/4/2025

Express Delivery: Save 22 days

Compare

Add to wishlist

Get an offer