« Back
Home /
S100 Calcium Binding Protein A8 Recombinant Protein

S100 Calcium Binding Protein A8 Recombinant Protein

Item no.	PRS-91-636-0.05mg
Manufacturer	ProSci
Amount	0.05 mg
Category	Oncology Neuroscience Neural Lineage Markers Neuroinflammation Molecular Targets for Neuroscience Targets for Rodent Neurosciences Aging & Neurological Disorders Neural Adhesion Molecules By Cell Type Melanoma Peptides & Proteins Recombinant Proteins Cell Biology Cytoskeleton Cytoskeleton Markers Oligodendrocyte Markers Progenitor Markers small GTPases Ras Subfamily
Type	Proteins Recombinant
Format	Lyophilized
Specific against	other
Conjugate/Tag	HIS
Purity	Greater than 95% as determined by reducing SDS-PAGE.<br />Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Sequence	MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKEHHHHHH
NCBI	S100A8
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Protein S100-A8, S100A8, Calgranulin-A, Cystic fibrosis antigen，Leukocyte L1 complex light chain, MRP-8, Mrp8
Available
Manufacturer - Applications	This recombinant protein can be used for biological assays. For research use only.
Manufacturer - Conjugate / Tag	C-6 His tag
Storage Conditions	Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Molecular Weight	11.7 kD
Background	Protein S100-A8 (also MRP8 and calgranulin A) is a calcium- and zinc-binding protein.It plays a prominent role in the regulation of inflammatory processes and immune response. S100A8 can induce neutrophil chemotaxis and adhesion. Its role as an oxidant scavenger has a protective role in preventing exaggerated tissue damage by scavenging oxidants. It can act as a potent amplifier of inflammation in autoimmunity as well as in cancer development and tumor spread.
Protein Gi #	189065303
Buffer	Lyophilized from a 0.2 um filtered solution of 20mM HEPES, 150mM NaCl, pH 7.4. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
NCBI Official Name	S100 calcium binding protein A8
NCBI Organism	Homo sapiens
Disclaimer	Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.05 mg

available

Delivery expected until 9/4/2025

Express Delivery: Save 15 days

Compare

Add to wishlist

Get an offer