Comparison

GDF-11 Recombinant Protein

Item no. PRS-91-641-0.05mg
Manufacturer ProSci
Amount 0.05 mg
Category
Type Proteins Recombinant
Format Lyophilized
Specific against other
Conjugate/Tag Tag Free
Purity Greater than 95% as determined by reducing SDS-PAGE.<br />Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Sequence NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS
NCBI GDF11
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Growth/differentiation factor 11, GDF-11, Bone morphogenetic protein 11, BMP-11
Available
Manufacturer - Applications
This recombinant protein can be used for biological assays. For research use only.
Storage Conditions
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at -20°C for 3 months.
Molecular Weight
12.6 kD
Background
Growth/differentiation factor 11(GDF-11) is a secreted protein, which belongs to the transforming growth factor beta superfamily. GDF-11 controls anterior-posterior patterning by regulating the expression of Hox genes. The secreted signal acts globally to specify positional identity along the anterior/posterior axis during development. GDF11 has been shown to suppress neurogenesis through a pathway similar to that of myostatin, including stopping the progenitor cell-cycle during G-phase. The similarities between GDF11 and myostatin imply a likelihood that the same regulatory mechanisms are used to control tissue size during both muscular and neural development.
Protein Gi #
119615488
Buffer
Lyophilized from a 0.2 um filtered solution of PBS, pH7.4. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
NCBI Official Name
growth differentiation factor 11
NCBI Organism
Homo sapiens
Disclaimer
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 0.05 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close