Comparison

WW Domain-Binding Protein 2 Recombinant Protein

Item no. PRS-91-988-0.05mg
Manufacturer ProSci
Amount 0.05 mg
Category
Type Proteins Recombinant
Format Lyophilized
Specific against other
Conjugate/Tag HIS
Purity Greater than 95% as determined by reducing SDS-PAGE.<br />Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Sequence MGSSHHHHHHSSGLVPRGSHMALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFLSKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEA
NCBI WBP2
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias WW Domain-Binding Protein 2, WBP-2, WBP2
Available
Manufacturer - Applications
This recombinant protein can be used for biological assays. For research use only.
Manufacturer - Conjugate / Tag
N-6 His tag
Storage Conditions
Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at -20°C for 3 months.
Molecular Weight
13.38 kD
Background
WW Domain-Binding Protein 2 (WBP2) is a ubiquitous protein that contains one GRAM domain. The WW domain is composed of 38 to 40 semi-conserved AA shared by proteins of diverse functions including structural, regulatory, and signaling proteins. The domain is participated in mediating protein-protein interactions. WBP2 binds to the WW domain of YAP1, WWP1 and WWP2. The WW-binding 1 motif of WBP2 mediates interaction with NEDD4. The function of this protein WBP2 has not been determined. Some researches demonstrate that WBP-2 also interacts with the thyroid-specific transcription factor Pax8.
Buffer
Lyophilized from a 0.2 um filtered solution of 20mM TrisHCl, 1mM DTT, pH 8.0. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
NCBI Official Name
WW domain binding protein 2
NCBI Organism
Homo sapiens
Disclaimer
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 0.05 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close