Comparison

Autophagy protein 4C Recombinant Protein

Item no. PRS-92-044-0.05mg
Manufacturer ProSci
Amount 0.05 mg
Category
Type Proteins Recombinant
Format Liquid
Specific against other
Conjugate/Tag HIS
Purity Greater than 95% as determined by reducing SDS-PAGE.<br />Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Dry ice Yes
Sequence MEATGTDEVDKLKTKFISAWNNMKYSWVLKTKTYFSRNSPVLLLGKCYHFKYEDEDKTLPAESGCTIEDHVIAGNVEEFRKDFISRIWLTYREEFPQIEGSALTTDCGWGCTLRTGQMLLAQGLILHFLGRAWTWPDALNIENSDSESWTSHTVKKFTASFEASLSGEREFKTPTISLKETIGKYSDDHEMRNEVYHRKIISWFGDSPLALFGLHQLIEYGKKSGKKAGDWYGPAVVAHILRKAVEEARHPDLQG
NCBI ATG4C
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Cysteine Protease ATG4C, AUT-Like 3 Cysteine Endopeptidase, Autophagin-3, Autophagy-Related Cysteine Endopeptidase 3, Autophagy-Related Protein 4 homolog C, ATG4C, APG4C, AUTL1, AUTL3
Available
Manufacturer - Applications
This recombinant protein can be used for biological assays. For research use only.
Manufacturer - Conjugate / Tag
C-6 His tag
Storage Conditions
Store at -20°C, stable for 6 months after receipt.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Molecular Weight
53.56 kD
Background
Cysteine Protease ATG4C (ATG4C) belongs to the peptidase C54 family. It is required for autophagy, which cleaves the C-terminal part of either MAP1LC3, GABARAPL2 or GABARAP, allowing the liberation of form I. A subpopulation of form I is subsequently converted to a smaller form which is considered to be the phosphatidylethanolamine (PE)-conjugated form, and has the capacity for the binding to autophagosomes. ATG4C is a cytoplasmic protein and high expressed in skeletal muscle, liver, testis and heart. ATG4C can be inhibited by N-ethylmaleimide.
Protein Gi #
530363504
Buffer
Supplied as a 0.2 um filtered solution of 20mM TrisHCl, 100mM NaCl, 10% Glycerol, pH 8.0. It is not recommended to reconstitute to a concentration less than 100 ug/ml.
NCBI Official Name
autophagy related 4C cysteine peptidase
NCBI Organism
Homo sapiens
Disclaimer
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 0.05 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close