Comparison

MAP1LC3A Recombinant Protein

Item no. PRS-92-048-0.05mg
Manufacturer ProSci
Amount 0.05 mg
Category
Type Proteins Recombinant
Format Liquid
Specific against other
Conjugate/Tag HIS
Purity Greater than 95% as determined by reducing SDS-PAGE.<br />Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Dry ice Yes
Sequence MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGFLEHHHHHH
NCBI MAP1LC3A
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Microtubule-Associated Proteins 1A/1B Light Chain 3A, Autophagy-Related Protein LC3 A, Autophagy-Related Ubiquitin-Like Modifier LC3 A, MAP1 Light Chain 3-Like Protein 1, MAP1A/MAP1B Light Chain 3 A, MAP1A/MAP1B LC3 A, Microtubule-Associated Protein 1 Light Chain 3 Alpha, MAP1LC3A
Available
Manufacturer - Applications
This recombinant protein can be used for biological assays. For research use only.
Manufacturer - Conjugate / Tag
C-6 His tag
Storage Conditions
Store at -20°C, stable for 6 months after receipt.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Molecular Weight
15.3 kD
Background
Microtubule-Associated Proteins 1A/1B Light Chain 3A (MAP1LC3A) belongs to the MAP1 LC3 family. MAP1LC3A is found most abundantly in the heart, brain, liver, skeletal muscle, and testis. But it is absent in the thymus and peripheral blood leukocytes. MAP1LC3A is thought to take part in the formation of autophagosomal vacuoles and is one of the light chain subunits that functions together with both MAP1A and/or MAP1B. In addition, MAP1A has an important part in neuronal development and in maintaining the balance between neuronal plasticity and rigidity.
Protein Gi #
530379522
Buffer
Supplied as a 0.2 um filtered solution of 20mM Tris, 20% Glycerol, 0.1M NaCl, pH 8.0. It is not recommended to reconstitute to a concentration less than 100 ug/ml.
NCBI Official Name
microtubule associated protein 1 light chain 3 alpha
NCBI Organism
Homo sapiens
Disclaimer
Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 0.05 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close