« Back
Home /
IL-33 Recombinant Protein

IL-33 Recombinant Protein

Item no.	PRS-92-200-0.05mg
Manufacturer	ProSci
Amount	0.05 mg
Category	Neuroscience Neural Lineage Markers Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins Cell Biology Cell Culture Cytokines Glial Cell Markers Neurodegeneration Markers;Research Area Neuroinflammation
Type	Proteins Recombinant
Format	Lyophilized
Specific against	other
Conjugate/Tag	Tag Free
Purity	Greater than 95% as determined by reducing SDS-PAGE.<br />Endotoxin level less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Sequence	MSIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
NCBI	Il33
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Interleukin 33, IL-33, IL33, C9orf26, NKHEV, Interleukin-1 family member 11, DVS27, NF-HEV and IL- 1F11
Available
Manufacturer - Applications	This recombinant protein can be used for biological assays. For research use only.
Storage Conditions	Lyophilized protein should be stored at -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at -20°C for 3 months.
Molecular Weight	17.6 kD
Background	Mouse Interleukin 33 (IL-33) is a proinflammatory cytokine which may also regulates gene transcription in producer cells. IL-33 is structurally related to IL-1, which induces helper T cells to produce type 2 cytokines and acts through the receptor IL1RL-1. BindingIL-33 to this receptor activates NF-kappa-B and MAP kinases and induces in vitro Th2 cells to produce cytokines. In vivo, IL-33 induces the expression of IL-4, IL-5, IL-13 and also leads to severe pathological changes in mucosal organs.
Protein Gi #	929654682
Buffer	Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH7.4. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O.
NCBI Official Name	interleukin 33
NCBI Organism	Mus musculus
Disclaimer	Products are intended for laboratory research purposes only and should be used by qualified personnel only. They are not intended for use in humans. ProSci is not liable for damages or injuries resulting from receipt and/or use of ProSci materials. Please refer to the Material Safety Data Sheet (MSDS) for safe storage, handling, and use procedures.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.05 mg

available

Delivery expected until 11/6/2025

Express Delivery: Save 27 days

Compare

Add to wishlist

Get an offer