Comparison

VEGF165b European Partner

Item no. RLT-300-082
Manufacturer ReliaTech
Amount 20ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Host E.coli
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Available
Synonyms
vascular endothelial growth factor A, VEGFA, VPF, VEGF, MVCD1
Description
Vascular endothelial growth factor-A (VEGF-A) is a potent mediator of both angiogenesis and vasculogenesis in the fetus and adult. Humans express two sets of alternately spliced isoforms of 121, 145, 165, 183, 189, and 206 amino acids. VEGF165 appears to be the most abundant and potent of the angiogenic isoform set, followed by VEGF121 and VEGF189. The anti-angiogenic or "b" set of isoforms is differentially spliced to contain six alternate amino acids at the C-terminus, and are the more highly expressed isoforms in normal adult tissue. VEGF165b, like VEGF121 but unlike most angiogenic isoforms, does not bind heparins and is therefore diffusible. VEGFs bind the type I transmembrane receptor tyrosine kinases VEGFR1 (Flt1) and VEGFR2 (Flk1/KDR) on endothelial cells. Although VEGF affinity is highest for binding to Flt1, KDR appears to be the primary mediator of VEGF angiogenic activity. The affinity of VEGF165b for KDR is similar to that of VEGF165, but VEGF165b only partially activates KDR such that the kinase regulatory site Y1054 is not phosphorylated. VEGF165b also does not bind Neuropilin-1, suggesting that the functional difference between VEGF165 and VEGF165b may be due to either the lack of Neuropilin-1 co-signaling or unique downstream signaling activated by VEGF165b. Since VEGF165b may compete with angiogenic VEGFs for KDR sites, its ectopic expression in tumors has been shown to inhibit their growth.
Formulation
lyophilized
Storage
Lyophilized samples are stable for greater than six months at -20C to -70C. Reconstituted VEGF165 should be stored in working aliquots at -20C.
Reconstitution
The lyophilized VEGF165 should be reconstituted in 50 mM acetic acid to a concentration not lower than 50 ug/ml. For long term storage we recommend to add at least 0.1% human or bovine serum albumin.
Length (aa)
164
Protein Sequence
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRSLTRKD
NCBI GeneID
7422
Accession Number Protein
NP_001165100.1?
Accession Numberm RNA
NM_001171629.1
Uniprot
P15692-8

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20ug
Available: In stock
available

Delivery expected until 8/21/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close