Comparison

Bovine adenosine deaminase

Item no. THP-0104
Manufacturer Creative BioMart
CASRN 9026-93-1
Amount 1ea
Category
Type Proteins
Specific against Cattle (Bovine)
Conjugate/Tag #NV
Sequence MAQTPAFNKPKVELHVHLDGAIKPETILYYGRKRGIALPADTPEELQNIIGMDKPLSLPEFLAKFDYYMPAIAGCREAVKRIAYEFVEMKAKDGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVSLVNQGLQEGERDFGVKVRSILCCMRHQPSWSSEVVELCKKYREQTVVAIDLAGDETIEGSSLFPGHVKAYAEAVKSGVHRTVHAGEVGSANVVKEAVDTLKTERLGHGYHTLEDATLYNRLRQE
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias 9026-93-1
Similar products 9026-93-1
Available
Affected organisms
Humans and other mammals
Applications info
For treatment of adenosine deaminase deficiency.
Description
Bovine adenosine deaminase derived from bovine intestine that has been extensively pegylated for extended serum half life.
Examples of Clinical Use
Adenosine deaminase deficiency
Mechanism of action
Pegademase converts adenosine (toxic) to inosine (less toxic) by deamination. It also converts 2'-deoxyadenosine to 2'-deoxyinosine via deamination.
Molecular Weight
40788.2 Da
Pharmacodynamics
Used to replace deficient or inactive adenosine deaminase which leads to severe combined immunodeficiency disease (SCID). The enzyme is responsible for converting adenosine to inosine. In the absence of adenosine deaminase, the purine substrates adenosine, 2'-deoxyadenosine and their metabolites are actually toxic to lymphocytes thereby leading to diminished immune function.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

 
Close