« Back
Home /
I-TAC (CXCL11)

I-TAC (CXCL11)

Item no.	RLT-100-058
Manufacturer	ReliaTech
Amount	20ug
Category	Peptides & Proteins Recombinant Proteins
Type	Cytokines and Growth Factors
Format	Lyophilized
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Monkey (Cynomolgus, Simian), Rabbit (Oryctolagus cuniculus), Hamster
Host	E.coli
ECLASS 10.1	42030690
ECLASS 11.0	42030690
UNSPSC	12352202
Alias	CXCL11, IP9, H174, IP-9, b-R1, I-TAC, SCYB11, SCYB9B
Available
NCBI Gene ID	6373
Uniprot	O14625
Biological Activity	Determined by its ability to chemoattract IL-2 activated T-cells using a concentration range of 0.1-10.0 ng/ml.
Description	Human I-TAC (Interferon-inducible T cell alpha chemoacttractant) is an 8.3 kDa protein containing 73 amino acid residues. I-TAC is a novel non-ELR CXC chemokine. It is regulated by Interferon and has potent chemoattractant activity for IL-2 activated T cells, but not for freshly isolated unstimulated T cells, neutrophils, or monocytes.
Endotoxin Levels	< 0.1 ng/µg of protein (<1EU/µg)
Length [aa]	73
Molecular Weight	8.3 kDa
mRNA RefSeq	NM_005409.4
Protein RefSeq	NP_005400.1
Protein Sequence	FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Purity Confirmation	> 98% by SDS-PAGE & HPLC analyses
Synonyms	CXCL11; IP9; H174; IP-9; b-R1; I-TAC; SCYB11; SCYB9B
Uniprot ID	O14625

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 20ug

available

Delivery expected until 9/18/2025

Express Delivery: Save 7 days

Compare

Add to wishlist

Get an offer