« Back
Home /
IP-10 (CXCL10)

IP-10 (CXCL10)

Item no.	RLT-100-057S
Manufacturer	ReliaTech
Amount	5ug
Category	Neuroscience Neuroinflammation Peptides & Proteins Recombinant Proteins
Type	Cytokines and Growth Factors
Format	Lyophilized
Specific against	Human (Homo sapiens), Mouse (Murine, Mus musculus), Monkey (Cynomolgus, Simian)
Host	E.coli
ECLASS 10.1	42030690
ECLASS 11.0	42030690
UNSPSC	12352202
Alias	CXCL10
Available
NCBI Gene ID	3627
Uniprot	P02778
Biological Activity	Determined by its ability to chemoattract human T-Lymphocytes using a concentration of 10-50 ng/ml.
Description	IP-10 is a CXC chemokine that signals through the CXCR3 receptor. IP-10 selectively chemoattracts Th1 lymphocytes and monocytes, and inhibits cytokine-stimulated hematopoietic progenitor cell proliferation. Additionally, it is angiostatic and mitogenic for vascular smooth muscle cells. Recombinant human IP-10 is an 8.6 kDa protein consisting of 77 amino acids including the four conserved cysteine residues present in CXC chemokines.
Endotoxin Levels	< 0.1 ng/µg of protein (<1EU/µg)
Length [aa]	77
Molecular Weight	8.6 kDa
mRNA RefSeq	NM_001565.3
Protein RefSeq	NP_001556.2
Protein Sequence	VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Purity Confirmation	> 98% by SDS-PAGE & HPLC analyses
Synonyms	CXCL10
Uniprot ID	P02778

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 5ug

available

Delivery expected until 8/21/2025

Express Delivery: Save 20 days

Compare

Add to wishlist

Get an offer