Comparison

EGF European Partner

Item no. RLT-100-009
Manufacturer ReliaTech
Amount 500ug
Category
Type Cytokines and Growth Factors
Format Lyophilized
Specific against Human (Homo sapiens), Mouse (Murine, Mus musculus)
Host E.coli
ECLASS 10.1 42030690
ECLASS 11.0 42030690
UNSPSC 12352202
Alias Epidermal growth factor, EGF, URG, HOMG4, Urogastrone,
Available
NCBI Gene ID
1950
Uniprot
P01133
Biological Activity
The biological activity was determined by the ability to induce EGF receptor phosphorylation in the A431 tumor cell line [Soler et al, J Chromatography B, 788, 2003] and the induction of proliferation in NHDF cells (Normal Human Dermal Fibroblasts).
Buffer
PBS
Description
Epidermal growth factor (EGF) is the founding member of the EGF family that also includes TGFa, amphiregulin (AR), betacellulin (BTC), epiregulin (EPR), heparin-binding EGF-like growth factor (HBEGF), epigen, and the neuregulins (NRG) 1 through 6. Members of the EGF family share a structural motif, the EGF-like domain, which is characterized by three intra-molecular disulfide bonds that are formed by six similarly spaced conserved cysteine residues. All EGF family members are synthesized as type I transmembrane precursor proteins that may contain several EGF domains in the extracellular region. The mature proteins are released from the cell surface by regulated proteolysis. The 1207 amino acid (aa) human EGF precursor contains nine EGF domains and nine LDLR class B repeats. The mature protein consists of 53 aa and is generated by proteolytic excision of the EGF domain proximal to the transmembrane region. Mature human EGF shares 70% aa sequence identity with mature mouse and rat EGF. EGF is present in various body fluids, including blood, milk, urine, saliva, seminal fluid, pancreatic juice, cerebrospinal fluid, and amniotic fluid. Four ErbB (HER) family receptor tyrosine kinases including EGFR/ErbB1, ErbB2, ErbB3 and ErbB4, mediate responses to EGF family members. EGF binds ErbB1 and depending on the context, induces the formation of homodimers or heterodimers containing ErbB2. Biological activities ascribed to EGF include epithelial development, angiogenesis, inhibition of gastric acid secretion, fibroblast proliferation, and colony formation of epidermal cells in culture.
Length [aa]
54
Molecular Weight
6.35 kDa
mRNA RefSeq
NM_1963.4
N Terminal Sequence
MNSDSECPLS
Protein RefSeq
NP_001954.2
Protein Sequence
MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Purity Confirmation
> 95% by SDS-PAGE & silver stain
Reconstitution
We recommend a quick spin followed by reconstitution in water to a concentration of 0.1-1.0 mg/ml.
Stability And Storage
The lyophilized protein is stable for a few weeks at room temperature, but best stored at -20 °C. Reconstituted EGF should be stored in working aliquots at -20 °C.
Synonyms
Epidermal growth factor; EGF; URG; HOMG4; Urogastrone;
Uniprot ID
P01133

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close