« Back
Home /
IL-36RA

IL-36RA

Item no.	RLT-100-414
Manufacturer	ReliaTech
Amount	25ug
Category	Oncology Neuroscience Neuroinflammation Metabolism Diabetes By Cell Type Carcinoma Peptides & Proteins Recombinant Proteins Obesity
Type	Cytokines and Growth Factors
Format	Lyophilized
Specific against	Human (Homo sapiens)
Host	E.coli
ECLASS 10.1	42030690
ECLASS 11.0	42030690
UNSPSC	12352202
Alias	FIL1 delta, IL-1F5, IL-1HY1, IL-1L1, IL-1RP3, IL-1ra homolog 1, IL-1 delta
Available
NCBI Gene ID	26525
Uniprot	Q9UBH0
Biological Activity	Measured by its ability to inhibit IL-36? induced IL-6 production by human PBMCs.
Description	The IL-1 family is comprised of 11 structurally related ligands, including the recently re-named IL-36RA (IL-1F5), IL-36a (IL-1F6), IL-36ß (IL-1F8), and IL-36? (IL-1F9). The interaction of IL-36 ligands with the IL-1Rrp2 receptor (IL-1R6) can induce various activities, including dendritic cell maturation and activation. IL-36RA can antagonize the NF-kappaB signaling induced by either IL-36a, -ß or -? by binding to the IL-1Rrp2 receptor in a manner that prevents the initiation of functional signaling. Recombinant human IL-36RA is an E. coli derived 17 kDa protein containing 154 amino acid residues.
Endotoxin Levels	< 0.1 ng/µg of protein (<1EU/µg)
Length [aa]	154
Molecular Weight	17 kDa
mRNA RefSeq	NM_012275.2
Protein RefSeq	NP_036407.1
Protein Sequence	VLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD
Purity Confirmation	> 98% by SDS-PAGE & HPLC analyses
Synonyms	FIL1 delta, IL-1F5, IL-1HY1, IL-1L1, IL-1RP3, IL-1ra homolog 1, IL-1 delta
Uniprot ID	Q9UBH0

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 25ug

available

Delivery expected until 8/21/2025

Express Delivery: Save 20 days

Compare

Add to wishlist

Get an offer