Comparison

PlGF-2 European Partner

Item no. RLT-300-019S
Manufacturer ReliaTech
Amount 2ug
Category
Type Cytokines and Growth Factors
Format Lyophilized
Specific against Human (Homo sapiens)
Host Insect Cells
ECLASS 10.1 42030690
ECLASS 11.0 42030690
UNSPSC 12352202
Alias PlGF, placental growth factor
Available
NCBI Gene ID
5281
Uniprot
P49763
Biological Activity
Measured by its ability to bind to immobilized rh-sFlt-1 in a functional ELISA. Recombinant human PlGF-2 can bind to immobilized rh-sFlt-1 (100 ng/well) with a linear range at 0.5 - 10 ng/mL.
Buffer
50mM acetic acid
Description
Human Placenta Growth Factor-2 (PlGF-2), a 22 kDa protein consisting of 152 amino acid residues is produced as a homodimer. PlGF is a polypeptide growth factor and a member of the platelet-derived growth factor family but more related to vascular endothelial growth factor (VEGF). PlGF acts only as a weak mitogen for those cell types possessing receptors for binding (e.g. vascular endothelial cells). At least one high-affinity receptor for PlGF (FLT-1 or VEGF-R1) has been demonstrated in different primary cell types (e.g. human umbilical vein endothelial cells and monocytes). In addition to its action as a weak mitogen it is also a chemoattractant for monocytes and endothelial cells. Two different proteins are generated by differential splicing of the human PlGF gene: PlGF-1 (131 aa native chain) and PlGF-2 (152 aa native chain). Both mitogens are secretable proteins, but PlGF-2 can bind to heparin with high affinity. PlGF is apparently a homodimer, but preparations of PlGF show some heterogeneity on SDS gels depending of the varying degrees of glycosylation. All dimeric forms posses similar biologcal activities. If PlGF is angiogenic in vivo is not clear. However, heterodimers between VEGF and PlGF are mitogenic for endothelial cells and have strong angiogenic activity in vivo (e.g. in the CAM assay or in the cornea pocket assay). Different cells and tissues (e.g. placenta) express PlGF-1 and PlGF-2 at different rates. A much related protein of PlGF is VEGF with about 53% homology and VEGF-B with similar biological activities.
Length [aa]
152
Molecular Weight
~45.0 kDa
mRNA RefSeq
NM_001207012.1
Protein RefSeq
NP_001193941.1
Protein Sequence
LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR
Purity Confirmation
> 95% by SDS-PAGE & visualized by silver stain
Reconstitution
Centrifuge vial prior to opening. The PlGF-2 is supplied in lyophilized form with carrier-protein (BSA) and can be reconstituted with 50mM acetic acid or PBS/water. This solution can be diluted into other buffered solutions or stored frozen for future use.
Stability And Storage
The lyophilized human PIGF-2, though stable at room temperature, is best stored in working aliquots at -20 °C to -70 °C
Stabilizer/Carrier
BSA (50-fold)
Synonyms
PlGF; placental growth factor
Uniprot ID
P49763

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 2ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close