Comparison

FGF-4 European Partner

Item no. RLT-M30-130
Manufacturer ReliaTech
Amount 5ug
Category
Type Cytokines and Growth Factors
Format Lyophilized
Specific against Mouse (Murine, Mus musculus)
Host E.coli
ECLASS 10.1 42030690
ECLASS 11.0 42030690
UNSPSC 12352202
Alias Fgf4, KS3, hst, Fgfk, Hst1, kFGF, Fgf-4, hst-1, Hstf-1
Available
NCBI Gene ID
14175
Uniprot
P11403
Biological Activity
The biological activity was determined by the induction of proliferation in NHDF cells (Normal Human Dermal Fibroblasts).
Buffer
0.5X PBS
Description
FGF4 (fibroblast growth factor4), also known as FGF-K or K-FGF (Kaposi’s sarcoma-associated FGF), is a 25 kDa secreted, heparin-binding member of the FGF family. The mouse FGF4 cDNA encodes 202 amino acids (aa) with a 29 aa signal sequence and a 173 aa mature protein with an FGF homology domain that contains a heparin binding region near the C-terminus. Mature mouse FGF 4 shares 87%, 90%, 87% and 85% aa identity with human, rat, canine and bovine FGF4, respectively. Human FGF4 has been shown to exhibit cross species activity. Expression of FGF4 and its receptors, FGF R1c, 2c, 3c and 4, is spatially and temporally regulated during embryonic development. Its expression in the trophoblast inner cell mass promotes expression of FGF R2, and is required for maintenance of the trophectoderm and primitive endoderm. Later in development, FGF4 works together with FGF8 to mediate the activities of the apical ectodermal ridge, which direct the outgrowth and patterning of vertebrate limbs. FGF4 is proposed to play a physiologically relevant role in human embryonic stem cell self-renewal. It promotes stem cell proliferation, but may also aid differentiation depending on context and concentration, and is often included in embryonic stem cell media in vitro. A C-terminally truncated 15 kDa isoform that opposes full length FGF4 and promotes differentiation is endogenously expressed in human embryonic stem cells. FGF4 is mitogenic for fibroblasts and endothelial cells in vitro and has autocrine transforming potential. It is a potent angiogenesis promoter in vivo and has been investigated as therapy for coronary artery disease.
Label
His-Tag
Length [aa]
195
Molecular Weight
21.6 kDa
mRNA RefSeq
NM_010202
Protein RefSeq
NP_034332
Protein Sequence
MGHHHHHHHHHHSSGHIEGRHMAPNGTRHAELGHGWDGLVARSLARLPVAAQPPQAAVRSGAGDYLLGLKRLRRLYCNVGIGFHLQVLPDGRIGGVHADTRDSLLELSPVQRGVVSIFGVASRFFVAMSSRGKLFGVPFFTDECKFKEILLPNNYNAYEAYAYPGMFMALSKNGRTKKGNRVSPTMKVTHFLPRL
Purity Confirmation
> 80% by SDS-PAGE & visualized by silver stain
Reconstitution
We recommend a quick spin followed by reconstitution in water to a concentration of 0.1-1.0mg/ml. This solution can then be diluted into other aqueous buffers and stored at 4 °C for 1 week or -20 °C for future use.
Stability And Storage
The lyophilized protein is stable for a few weeks at room temperature, but best stored at -20 °C. Reconstituted FGF-4 should be stored in working aliquots at -20 °C. Avoid repeated freeze-thaw cycles.
Synonyms
Fgf4; KS3; hst; Fgfk; Hst1; kFGF; Fgf-4; hst-1; Hstf-1
Uniprot ID
P11403

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 5ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close