Comparison

FGF-2 (basic) European Partner

Item no. RLT-R20-060
Manufacturer ReliaTech
Amount 50ug
Category
Type Cytokines and Growth Factors
Format Lyophilized
Specific against Rat (Rattus norvegicus)
Host E.coli
ECLASS 10.1 42030690
ECLASS 11.0 42030690
UNSPSC 12352202
Alias Fgf2, bFGF, Fgf-2
Available
NCBI Gene ID
54250
Uniprot
P13109
Biological Activity
The ED50 for stimulation of cell proliferation in human umbilical vein endothelial cells (HUVEC) by mouse FGF-2 has been determined to be in the range of 0.1-2 ng/ml.
Buffer
0.5X PBS
Description
The FGF family is composed of at least 23 polypeptides that show a variety of biological activities towards cells of mesenchymal, neuronal and epithelial origin. All members are heparin-binding growth factors (HB-GF). Until the structure of basic fibroblast growth factor (bFGF/FGF-2) was determined, a number of synonyms were used to describe this growth factor. As is often the case, the nomenclature reflected the observed activities reported by individual groups. Basic FGF has been reported as leukemia growth factor, macrophage growth factor, endothelial growth factor and tumor angiogenesis factor. The eventual isolation and characterization of bFGF was done from soluble brain extracts. bFGF was found to have a molecular mass of 16.5 kDa and to be 154 amino acids in length. Interestingly, bFGF contains no hydrophobic leader sequence previously thought to be required for cell secretion. Basic FGF bears 55% homology to acidic FGF and also seems to exist in three forms: the 154 amino-acid form and two other truncated versions of 146 and 131 amino acids lacking the N-terminal 9 and 24 residues. Acidic and basic FGF compete for the binding to 125 kDa and 145 kDa receptor species. However, acidic FGF has a higher affinity for the 125 kDa species, while basic FGF has a higher affinity for the 145 kDa species. FGF receptor activation leads to the activation of MAP kinase and protein kinase C. FGF’s induce the proliferative response in cells derived from mesoderm and neuroectoderm. Perhaps one of the most potentially significant applications of bFGF is related to its reported ability to induce angiogenesis. The cDNA of native rat FGF-2 (Ala11-Ser154) was cloned from total RNA derived from a rat embryo using standard protocols.
Endotoxin Levels
< 0.1 ng per µg of rat FGF-2
Length [aa]
145
Molecular Weight
16.34 kDa
mRNA RefSeq
NM_019305.2
N Terminal Sequence
ALPEDGGGAFPP
Protein RefSeq
NP_062178.1
Protein Sequence
ALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Purity Confirmation
> 98% by SDS-PAGE & visualized by silver stain
Reconstitution
The rat FGF-2 is supplied in lyophilized form and can be reconstituted with ddH2O at 50 µg/mL. This solution can be diluted into other buffered solutions or stored frozen for future use.
Stability And Storage
The lyophilized rat FGF-2, though stable at room temperature, is best stored in working aliquots at -20 °C to -70 °C
Synonyms
Fgf2; bFGF; Fgf-2
Uniprot ID
P13109

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close