Comparison

PlGF European Partner

Item no. RLT-R20-061S
Manufacturer ReliaTech
Amount 2ug
Category
Type Cytokines and Growth Factors
Format Lyophilized
Specific against Rat (Rattus norvegicus)
Host Insect Cells
ECLASS 10.1 42030690
ECLASS 11.0 42030690
UNSPSC 12352202
Alias Pgf, Plgf, placental growth factor
Available
NCBI Gene ID
94203
Uniprot
Q63434
Biological Activity
Measured by its ability to bind to immobilized rh-sFlt-1 in a functional ELISA. Recombinant rat PlGF can bind to immobilized rh-sFlt-1 (100ng/well) with a linear range at 0.1 - 5ng/mL
Buffer
25 mM Tris, pH 8.5
Description
Placenta growth factor (PlGF) is a member of the PDGF/VEGF family of growth factors that share a conserved pattern of eight cysteines. Alternate splicing results in at least three human mature PlGF forms containing 131 (PlGF-1), 152 (PlGF-2), and 203 (PlGF-3) amino acids (aa) respectively. Only PlGF-2 contains a highly basic heparin-binding 21 aa insert at the C-terminus. In rat only one PlGF that is the equivalent of human PlGF-2 has been identified. Rat PlGF shares 60%, 92%, 62% and 59% aa identity with the appropriate isoform of human, mouse, canine and equine PlGF. PlGF is mainly found as variably glycosylated, secreted, 55 - 60 kDa disulfide linked homodimers. Mammalian cells expressing PlGF include villous trophoblasts, decidual cells, erythroblasts, keratinocytes and some endothelial cells. Circulating PlGF increases during human pregnancy, reaching a peak in mid-gestation
Length [aa]
135
Molecular Weight
15.14 kDa
mRNA RefSeq
NP_446047.1
N Terminal Sequence
ALSAGNNSTEMEV
Protein RefSeq
Q63434
Protein Sequence
this increase is attenuated in preeclampsia. However, deletion of PlGF in the mouse does not affect development or reproduction. Postnatally, mice lacking PlGF show impaired angiogenesis in response to ischemia. PlGF binds and signals through VEGF R1/Flt-1, but not VEGF R2/Flk-1/KDR, while VEGF binds both but signals only through the angiogenic receptor, VEGF R2. PlGF and VEGF therefore compete for binding to VEGF R1, allowing high PlGF to discourage VEGF/VEGF R1 binding and promote VEGF/VEGF R2-mediated angiogenesis. However, PlGF (especially human PlGF-1) and some forms of VEGF can form dimers that decrease the angiogenic effect of VEGF on VEGF R2. PlGF-2, like VEGF164/165, shows heparin-dependent binding of neuropilin (Npn)-1 and Npn-2 and can inhibit nerve growth cone collapse. PlGF induces monocyte activation, migration, and production of inflammatory cytokines and VEGF. These activities facilitate wound and bone fracture healing, but also contribute to inflammation in active sickle cell disease and atherosclerosis. Circulating PlGF often correlates with tumor stage and aggressiveness, and therapeutic PlGF antibodies are being investigated to inhibit tumor growth and angiogenesis.
Purity Confirmation
> 95% by SDS-PAGE & visualized by silver stain
Reconstitution
Centrifuge vial prior to opening. The rat PlGF is supplied in lyophilized form and can be reconstituted with water. This solution can be diluted into other buffered solutions or stored frozen for future use.
Stability And Storage
The lyophilized rat PIGF, though stable at room temperature, is best stored in working aliquots at -20 °C to -70 °C.
Synonyms
Pgf; Plgf; placental growth factor
Uniprot ID
ALSAGNNSTEMEVVPFNEVWGRSYCRPMEKLVYIADEHPNEVSHIFSPSCVLLSRCSGCCGDEGLHCVALKTANITMQILKIPPNRDPHSYVEMTFSQDVLCECRPILETTKAERRKTKGKRKQSKTPQTEEPHL

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 2ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close