Comparison

Alpha-Synuclein, 1-60

Item no. RPE-S-1011-1
Manufacturer rPeptide
Amount 0.5 mg
Category
Type Proteins
Format Lyophilized
Specific against other
Purity >95% by SDS-PAGE
Sequence MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYV GSKTKEGVVHGVATVAEKTK
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Shipping Condition Room temperature
Available
Manufacturer - Category
Human, Native and Mutant Synucleins Recombinant, E. Coli
Shipping Temperature
Ambient
Storage Conditions
-20°C
Description
A deletion Mutant of α-synuclein (amino acids 1-60), which contains the N-terminal amphipathic domain. Alpha-Synuclein (α-Synuclein) is a 14 kD (140 amino acids) acidic presynaptic protein. It is a major component of Parkinson’s disease aggregates and is implicated in the pathogenesis of Parkinson’s Disease and related neurodegenerative disorders. α-Synuclein accumulates in the brains of sporadic Parkinson’s disease patients as a major component of Lewy bodies, which are intraneuronal cytoplasmic inclusions characteristic of Parkinson’s disease. α-Synuclein appears to associate with other proteins that aggregate and is found in βamyloid plaques and neuritic tangles in Alzheimer’s disease .
Physical State
White lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 0.5 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close