CCL18 (C-C Motif Chemokine 18,Alternative Macrophage Activation-associated CC Chemokine 1,AMAC-1,CC Chemokine PARC,Dendritic Cell Chemokine 1,DC-CK1,Macrophage Inflammatory Protein 4,MIP-4,Pulmonary and Activation-regula

Mab

IgG2b, k

-20°C

Supplied as a liquid in PBS, pH 7.4.

Partial recombinant corresponding to aa21-89 from human CCL18 with GST tag. MW of the GST tag alone is 26kD.

Chemotactic factor that attracts lymphocytes but not monocytes or granulocytes. May be involved in B-cell migration into B-cell follicles in lymph nodes. Attracts naive T-lymphocytes toward dendritic cells and activated macrophages in lymph nodes, has chemotactic activity for naive T-cells, CD4+ and CD8+ T-cells and thus may play a role in both humoral and cell-mediated immunity responses.

Applications:
Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested.

Recommended Dilutions:
Optimal dilutions to be determined by the researcher.

Amino Acid Sequence:
AQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.