ELAC2 (HPC2, Zinc Phosphodiesterase ELAC Protein 2, ElaC Homolog Protein 2, Heredity Prostate Cancer Protein 2, Ribonuclease Z 2, tRNA 3 Endonuclease 2, tRNase Z 2, FLJ10530, FLJ36693, FLJ42848)

Mab

IgG2a, k

-20°C

Supplied as a liquid in PBS, pH 7.2.

Partial recombinant corresponding to aa2-101 from human ELAC2 (NP_060597) with GST tag. MW of the GST tag alone is 26kD.

ELAC2 has a C-terminal domain with tRNA; processing endoribonuclease activity, which catalyzes the removal of the 3' trailer from precursor tRNAs. The protein also interacts with activated Smad family member 2 (Smad2) and its nuclear partner forkhead box H1 (also known as FAST-1), and reduced expression can suppress transforming growth factor-beta induced growth arrest.

Applications:
Suitable for use in Immunofluorescence and ELISA. Other applications not tested.

Recommended Dilution:
Immunofluorescence: 10ug/ml
Optimal dilutions to be determined by the researcher.

AA Sequence:
WALCSLLRSAAGRTMSQGRTISQAPARRERPRKDPLRHLRTREKRGPSGCSGGPNTVYLQVVAAGSRDSGAALYVFSEFNRYLFNCGEGVQRLMQEHKL

Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.