BPTF, Recombinant, Human, aa2791-2911, His-Tag (Bromodomain and PHD Finger Containing 4, FALZ, Fetal Alzheimer Antigen)

Dry Ice

15, 2

Supplied as a liquid in 45mM Tris-HCl, pH 8.0, 124mM sodium chloride, 2.4mM potassium chloride, 225mM imidazole, 3mM DTT, 10% glycerol.

FALZ is a bromodomain-containing protein that is the histone-binding component of NURF (nucleosome-remodeling factor), a complex which catalyzes ATP-dependent nucleosome sliding and facilitates transcription of chromatin. Specifically recognizes H3 tails trimethylated on Lys4 (H3K4me3), which mark transcription start sites of virtually all active genes. May also regulate transcription through direct binding to DNA or transcription factors. High levels of FALZ were detected in fetal brain and in patients with neurodegenerative diseases.

Source:
Recombinant protein corresponding to a single bromodomain, aa2791-2911, from human BPTF, fused to His-tag at N-terminal, expressed in E. coli.

Molecular Weight:
~15.2kD

AA Sequence:
MHHHHHHSTEDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAWPFLEPVDPNDAPDYYG
VIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFV
QKLKGFKASRSH

Applications:
Suitable for the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested.

Recommended Dilution:
Optimal dilutions to be determined by the researcher.

Storage and Stability:
Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.