Vergleich

Tyrosine Hydroxylase Rabbit pAb Europäischer Partner

ArtNr A12756-1000uL
Hersteller Abclonal
Menge 1000 uL
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie
Typ Antibody Polyclonal
Applikationen WB, IF, ICC, ELISA, IHC-P
Specific against Human (Homo sapiens)
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
Sequence KQNGEVKAYGAGLLSSYGELLHCLSEEPEIRAFDPEAAAVQPYQDQTYQSVYFVSESFSDAKDKLRSYASRIQRPFSVKFDPYTLAIDVLDSPQAVRRSLEGVQDELDTLAHALSAIG
NCBI TH
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias TYH, DYT14, DYT5b, Tyrosine Hydroxylase
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Background
The protein encoded by this gene is involved in the conversion of tyrosine to dopamine. It is the rate-limiting enzyme in the synthesis of catecholamines, hence plays a key role in the physiology of adrenergic neurons. Mutations in this gene have been associated with autosomal recessive Segawa syndrome. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 411-528 of human Tyrosine Hydroxylase (NP_954986.2).
Recommended Dilution
WB, 1:1000 - 1:5000|IHC-P, 1:50 - 1:200|IF/ICC, 1:50 - 1:200
Protein Size
59kDa
Route
Recombinant protein
Manufacturer - Research Area
Protein phosphorylation, Cancer, Signal Transduction, G protein signaling, G-Protein-Coupled Receptors Signaling to MAPK Erk, Endocrine Metabolism, Amino acid metabolism, Neuroscience, Cell Type Marker, Neurodegenerative Diseases, Dopamine Signaling in Parkinson's Disease, Neuron marker

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1000 uL
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen