Vergleich

IFIH1 Rabbit pAb Europäischer Partner

ArtNr A13645-1000uL
Hersteller Abclonal
Menge 1000 uL
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie
Typ Antibody Polyclonal
Applikationen WB, IF, ICC, ELISA, IHC-P
Specific against Human (Homo sapiens)
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
Sequence MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTVATSGNMQAVELLLSTLEKGVWHLGWTREFVEALRRTGSPLAARYMNPELTDLPSPSFENAHDEYLQLLNLLQPTLVDKLLVRDVLDKCMEEELLTIEDRNRIAAAENNGNESGVRELLKRIVQKENWFSAFLNVLRQTGNNELVQELTGSDCSES
NCBI IFIH1
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias AGS7, Hlcd, MDA5, IMD95, MDA-5, RLR-2, IDDM19, SGMRT1, IFIH1
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Background
IFIH1 encodes MDA5 which is an intracellular sensor of viral RNA that triggers the innate immune response. Sensing RNA length and secondary structure, MDA5 binds dsRNA oligonucleotides with a modified DExD/H-box helicase core and a C-terminal domain, thus leading to a proinflammatory response that includes interferons. It has been shown that Coronaviruses (CoVs) as well as various other virus families, are capable of evading the MDA5-dependent interferon response, thus impeding the activation of the innate immune response to infection. MDA5 has also been shown to play an important role in enhancing natural killer cell function in malaria infection. In addition to its protective role in antiviral responses, MDA5 has been implicated in autoimmune and autoinflammatory diseases such as type 1 diabetes, systemic lupus erythematosus, and Aicardi-Goutieres syndrome
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-205 of human IFIH1 (NP_071451.2).
Recommended Dilution
WB, 1:500 - 1:1000|IHC-P, 1:50 - 1:200|IF/ICC, 1:50 - 1:200
Protein Size
117kDa
Route
Recombinant protein
Manufacturer - Research Area
Epigenetics Nuclear Signaling, Cell Biology Developmental Biology, Apoptosis, Immunology Inflammation, Cytokines, Cell Intrinsic Innate Immunity Signaling Pathway

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1000 uL
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen