Vergleich

[KO Validated] Bak Rabbit pAb Europäischer Partner

ArtNr A18002-1000uL
Hersteller Abclonal
Menge 1000 uL
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie
Typ Antibody Polyclonal
Applikationen WB, ELISA
Specific against Human (Homo sapiens)
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
Sequence MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEMVTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHL
NCBI BAK1
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias BAK, CDN1, BCL2L7, BAK-LIKE, ak
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Background
The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mitochondria, and functions to induce apoptosis. It interacts with and accelerates the opening of the mitochondrial voltage-dependent anion channel, which leads to a loss in membrane potential and the release of cytochrome c. This protein also interacts with the tumor suppressor P53 after exposure to cell stress.
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Bak (NP_001179.1).
Recommended Dilution
WB, 1:500 - 1:2000
Protein Size
23kDa
Route
Synthetic peptide
Manufacturer - Research Area
Cell Biology Developmental Biology, Apoptosis, Mitochondrial Control of Apoptosis, Endocrine Metabolism, Mitochondrial metabolism

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1000 uL
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen