« Zurück
Startseite /
Lactate Dehydrogenase C Rabbit mAb

Lactate Dehydrogenase C Rabbit mAb

ArtNr	A20866-100uL
Hersteller	Abclonal
Menge	100 uL
Quantity options	1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Kategorie	Antibodies Primary Antibodies
Typ	Antibody Monoclonal
Applikationen	WB, ELISA
Specific against	Human (Homo sapiens)
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	MSTVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTSKITSGKDYSVSANSRIVIVTAGARQ
NCBI	LDHC
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Alias	CT32, LDH3, LDHX, Lactate Dehydrogenase C
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Monoclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Background	Lactate dehydrogenase C catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. LDHC is testis-specific and belongs to the lactate dehydrogenase family. Two transcript variants have been detected which differ in the 5' untranslated region.
Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Lactate Dehydrogenase C (P07864).
Recommended Dilution	WB, 1:100 - 1:500
Protein Size	36kDa
Route	Synthetic peptide
Manufacturer - Research Area	Cancer, Tumor biomarkers, Signal Transduction, Endocrine Metabolism

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A20866-100uL-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 uL

lieferbar

Lieferung vsl. bis 11.09.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern