Vergleich

Mineralocorticoid receptor (NR3C2) Rabbit mAb Europäischer Partner

ArtNr A21058-20uL
Hersteller Abclonal
Menge 20 uL
Quantity options 1000 uL 100 uL 200 uL 20 uL 500 uL 50 uL
Kategorie
Typ Antibody Monoclonal
Applikationen WB, ELISA
Specific against Human (Homo sapiens)
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
Sequence FPFMDGSYFSFMDDKDYYSLSGILGPPVPGFDGNCEGSGFPVGIKQEPDDGSYYPEASIPSSAIVGVNSGGQSFHYRIGAQGTISLSRSARDQSFQHLSSFPPVNTLVESWKSHGDLSSRRSDGYPVLEYIPENVSSSTLRSVSTGSSRPS
NCBI NR3C2
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias MR, MCR, MLR, NR3C2VIT, Mineralocorticoid receptor (NR3C2)
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Monoclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Availability
Inquiry before order
Background
This gene encodes the mineralocorticoid receptor, which mediates aldosterone actions on salt and water balance within restricted target cells. The protein functions as a ligand-dependent transcription factor that binds to mineralocorticoid response elements in order to transactivate target genes. Mutations in this gene cause autosomal dominant pseudohypoaldosteronism type I, a disorder characterized by urinary salt wasting. Defects in this gene are also associated with early onset hypertension with severe exacerbation in pregnancy. Alternative splicing results in multiple transcript variants.
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 450-600 of human Mineralocorticoid receptor (NR3C2) (NP_000892.2).
Recommended Dilution
WB, 1:500 - 1:1000
Protein Size
107kDa
Route
Recombinant protein
Manufacturer - Research Area
Epigenetics Nuclear Signaling, Transcription Factors, Nuclear Receptor Signaling, Nuclear hormone receptors, Signal Transduction, Cardiovascular, Heart, Hypertrophy, Cardiovascular diseases

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 20 uL
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 11.09.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen