Vergleich

β-Amyloid(1-40) Rabbit mAb Europäischer Partner

ArtNr A24949-20ul
Hersteller Abclonal
Menge 20 ul
Quantity options 1000 uL 100 uL 200 uL 20 ul 500 uL 50 uL
Applikationen IF, ICC, ELISA, IHC-P, Dot
Specific against Human (Homo sapiens)
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
NCBI APP
Alias AAA,AD1,PN2,ABPP,APPI,CVAP,ABETA,PN-II,preA4,CTFgamma,alpha-sAPP,β-Amyloid(1-40)
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Monoclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight
87kDa
Background
This gene encodes a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. In addition, two of the peptides are antimicrobial peptides, having been shown to have bacteriocidal and antifungal activities. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene.
Manufacturer - Cross Reactivity
Mouse
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 671-770 of human β-Amyloid(1-40)(NP_000475.1).
Protein Size
87kDa
Route
Synthetic peptide
Manufacturer - Research Area
Epigenetics Nuclear Signaling, Transcription Factors, Protein phosphorylation, Signal Transduction, G protein signaling, Cell Biology Developmental Biology, Apoptosis, Immunology Inflammation, Jak-Stat-IL-6 Receptor Signaling Pathway, Neuroscience, Neurodegenerative Diseases, Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimer's Disease, Neurodegenerative Diseases Markers.
Antigen Seq
MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
Manufacturer - Gene ID (Human)
351
Expected Protein Size
87kDa
Gene Symbol
APP

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 20 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen