Vergleich

α-Synuclein Rabbit mAb Europäischer Partner

ArtNr A24950-500uL
Hersteller Abclonal
Menge 500 uL
Quantity options 1000 uL 100 uL 200 uL 20 ul 500 uL 50 uL
Applikationen WB, IF, IP, ICC, ELISA, IHC-P
Specific against Human (Homo sapiens)
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
NCBI SNCA
Alias PD1,NACP,PARK1,PARK4,α-Synuclein
Lieferbar
Manufacturer - Category
Monoclonal Antibodies
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.09% Sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight
14kDa
Background
Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease. Alternatively spliced transcripts encoding different isoforms have been identified for this gene.
Manufacturer - Cross Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human α-Synuclein(NP_000336.1).
Recommended Dilution
WB, 1:1000 - 1:2000|IHC-P, 1:200 - 1:2000|IF/ICC, 1:200 - 1:800|IP, 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells|ELISA, Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Route
Recombinant protein
Manufacturer - Research Area
Protein phosphorylation, Cell Biology Developmental Biology, Apoptosis, Neuroscience, Neurodegenerative Diseases, Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimer's Disease, Dopamine Signaling in Parkinson's Disease, Neurodegenerative Diseases Markers.
Antigen Seq
MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Manufacturer - Gene ID (Human)
6622
Expected Protein Size
14kDa
Gene Symbol
SNCA

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 500 uL
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen