Vergleich

CD150/SLAM Rabbit mAb Europäischer Partner

ArtNr A24977-1000uL
Hersteller Abclonal
Menge 1000 uL
Quantity options 1000 uL 100 uL 200 uL 20 ul 500 uL 50 uL
Applikationen FC
Specific against Mouse (Murine, Mus musculus)
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
NCBI Slamf1
Alias Slam,CD150,IPO-3,CDw150,ESTM51,4933415F16,CD150/SLAM
Lieferbar
Manufacturer - Category
Monoclonal Antibodies
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Protein Weight
38kDa
Background
Enables identical protein binding activity and signaling receptor activity. Involved in natural killer cell activation; positive regulation of activated T cell proliferation; and regulation of cytokine production. Acts upstream of or within several processes, including leukocyte chemotaxis involved in inflammatory response; positive regulation of leukocyte chemotaxis; and regulation of vesicle fusion. Located in external side of plasma membrane and phagocytic vesicle. Is expressed in liver lobe. Orthologous to human SLAMF1 (signaling lymphocytic activation molecule family member 1).
Manufacturer - Cross Reactivity
Mouse
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 25-242 of mouse CD150/SLAM (NP_038758.2).
Recommended Dilution
FC, 1:100 - 1:500
Route
Recombinant protein
Manufacturer - Research Area
Immunology, Cell Type Markers, CD, Non-lineage; Stem Cells, Hematopoietic Progenitors, Hematopoietic Stem Cells, HSC markers.
Antigen Seq
TGGGVMDCPVILQKLGQDTWLPLTNEHQINKSVNKSVRILVTMATSPGSKSNKKIVSFDLSKGSYPDHLEDGYHFQSKNLSLKILGNRRESEGWYLVSVEENVSVQQFCKQLKLYEQVSPPEIKVLNKTQENENGTCSLLLACTVKKGDHVTYSWSDEAGTHLLSRANRSHLLHITLSNQHQDSIYNCTASNPVSSISRTFNLSSQACKQESSSESSP
Manufacturer - Gene ID (Human)
6504
Expected Protein Size
38kDa
Gene Symbol
Slamf1

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1000 uL
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen