Vergleich

PRMT6 Rabbit mAb Europäischer Partner

ArtNr A5085-100ul
Hersteller Abclonal
Menge 100 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie
Typ Antibody Monoclonal
Applikationen WB, ELISA
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
Sequence MLEWRLGFWSQVKQHYGVDMSCLEGFATRCLMGHSEIVVQGLSGEDVLARPQRFAQLELSRAGLEQELEAGVGGRFRCSCYGSAPMHGFAIWFQVTFPGGE
NCBI PRMT6
ECLASS 10.1 42030590
ECLASS 11.0 42030590
UNSPSC 12352203
Alias HRMT1L6, PRMT6
Similar products HRMT1L6
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Monoclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Background
The protein encoded by this gene belongs to the arginine N-methyltransferase family, which catalyze the sequential transfer of methyl group from S-adenosyl-L-methionine to the side chain nitrogens of arginine residues within proteins, to form methylated arginine derivatives and S-adenosyl-L-homocysteine. This protein can catalyze both, the formation of omega-N monomethylarginine and asymmetrical dimethylarginine, with a strong preference for the latter. It specifically mediates the asymmetric dimethylation of Arg2 of histone H3, and the methylated form represents a specific tag for epigenetic transcriptional repression. This protein also forms a complex with, and methylates DNA polymerase beta, resulting in stimulation of polymerase activity by enhancing DNA binding and processivity.
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 200-300 of human PRMT6 (Q96LA8).
Recommended Dilution
WB, 1:500 - 1:1000
Protein Size
42kDa
Route
Synthetic Peptide
Manufacturer - Research Area
Epigenetics Nuclear Signaling, Epigenetic writers and erasers of core Histones

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen