CREB1 Rabbit pAb

ArtNr	A11064-20ul
Hersteller	Abclonal
Menge	20 ul
Quantity options	1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie	Antibodies Western Blot Immunofluorescence Primary Antibodies
Typ	Antibody Polyclonal
Applikationen	WB, IP, ELISA
Specific against	Human (Homo sapiens)
Host	Rabbit
Isotype	IgG
Konjugat/Tag	Unconjugated
Purity	Affinity purification
Sequence	MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPNGQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
NCBI	CREB1
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Alias	CREB, CREB-1, CREB1
Versandbedingung	Gekühlt
Lieferbar
Manufacturer - Category	Polyclonal Antibodies
Shipping Temperature	ice pack
Storage Conditions	Store at -20°C. Avoid freeze / thaw cycles.\|Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Background	This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds as a homodimer to the cAMP-responsive element, an octameric palindrome. The protein is phosphorylated by several protein kinases, and induces transcription of genes in response to hormonal stimulation of the cAMP pathway. Alternate splicing of this gene results in several transcript variants encoding different isoforms.
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human CREB1 (NP_604391.1).
Recommended Dilution	WB, 1:500 - 1:1000\|IP, 1:500 - 1:1000
Protein Size	35kDa
Route	Recombinant protein
Manufacturer - Research Area	Epigenetics Nuclear Signaling, Transcription Factors, Protein phosphorylation, Signal Transduction, G protein signaling, ErbB-HER Signaling Pathway, MAPK-Erk Signaling Pathway, ATM Signaling Pathway, Cell Biology Developmental Biology, Apoptosis, Inhibition of Apoptosis, Endocrine Metabolism, Mitochondrial metabolism, Immunology Inflammation, B Cell Receptor Signaling Pathway, T Cell Receptor Signaling Pathway, Toll-like Receptor Signaling Pathway, Cell Intrinsic Innate Immunity Signaling Pathway, TLR Signaling, Neuroscience, Neurodegenerative Diseases, Dopamine Signaling in Parkinson's Disease

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

A11064-20ul-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 ul

lieferbar

Lieferung vsl. bis 04.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern