Vergleich

U2AF1 Rabbit pAb Europäischer Partner

ArtNr A13166-100ul
Hersteller Abclonal
Menge 100 ul
Quantity options 1000 uL 100 ul 200 ul 20 ul 500 uL 50 ul
Kategorie
Typ Antibody Polyclonal
Applikationen WB, IP, ELISA, IHC-P
Specific against Human (Homo sapiens)
Host Rabbit
Isotype IgG
Konjugat/Tag Unconjugated
Purity Affinity purification
Sequence MAEYLASIFGTEKDKVNCSFYFKIGACRHGDRCSRLHNKPTFSQTIALLNIYRNPQNSSQSADGLRCAVSDVEMQEHYDEFFEEVFTEMEEKYGEVEEMN
NCBI U2AF1
ECLASS 10.1 32160702
ECLASS 11.0 32160702
UNSPSC 12352203
Alias RN, FP793, U2AF35, U2AFBP, RNU2AF1, U2AF1
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Category
Polyclonal Antibodies
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C. Avoid freeze / thaw cycles.|Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Background
This gene belongs to the splicing factor SR family of genes. U2 auxiliary factor, comprising a large and a small subunit, is a non-snRNP protein required for the binding of U2 snRNP to the pre-mRNA branch site. This gene encodes the small subunit which plays a critical role in both constitutive and enhancer-dependent RNA splicing by directly mediating interactions between the large subunit and proteins bound to the enhancers. Alternatively spliced transcript variants encoding different isoforms have been identified.
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human U2AF1 (NP_006749.1).
Recommended Dilution
WB, 1:500 - 1:2000|IHC-P, 1:100 - 1:200|IP, 1:500 - 1:1000
Protein Size
28kDa
Route
Synthetic peptide
Manufacturer - Research Area
Epigenetics Nuclear Signaling, RNA Binding, Cell Biology Developmental Biology, Apoptosis

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ul
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen